Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 58714..59450 | Replicon | plasmid pATCCBAA2146_3 |
| Accession | NZ_CP117225 | ||
| Organism | Klebsiella pneumoniae strain ATCC BAA2146 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | PQQ24_RS01125 | Protein ID | WP_003026803.1 |
| Coordinates | 58968..59450 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | PQQ24_RS01120 | Protein ID | WP_003026799.1 |
| Coordinates | 58714..58980 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ24_RS01095 (PQQ24_01095) | 53805..54152 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PQQ24_RS01100 (PQQ24_01100) | 54201..55739 | + | 1539 | WP_004201219.1 | IS66-like element ISKpn24 family transposase | - |
| PQQ24_RS01105 (PQQ24_01105) | 56638..56946 | - | 309 | WP_017896554.1 | hypothetical protein | - |
| PQQ24_RS01110 (PQQ24_01110) | 57440..57988 | + | 549 | WP_001567366.1 | thioredoxin fold domain-containing protein | - |
| PQQ24_RS01115 (PQQ24_01115) | 58035..58469 | + | 435 | WP_001567367.1 | cell envelope integrity protein TolA | - |
| PQQ24_RS01120 (PQQ24_01120) | 58714..58980 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| PQQ24_RS01125 (PQQ24_01125) | 58968..59450 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| PQQ24_RS01130 (PQQ24_01130) | 59651..61054 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| PQQ24_RS01135 (PQQ24_01135) | 61083..61715 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| PQQ24_RS01140 (PQQ24_01140) | 61941..62132 | + | 192 | Protein_61 | helix-turn-helix domain-containing protein | - |
| PQQ24_RS01145 (PQQ24_01145) | 62333..64096 | + | 1764 | WP_004200842.1 | DUF262 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) / mph(A) | - | 1..117755 | 117755 | |
| - | inside | IScluster/Tn | - | - | 53404..61054 | 7650 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T270094 WP_003026803.1 NZ_CP117225:58968-59450 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |