Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2093700..2094229 | Replicon | chromosome |
| Accession | NZ_CP117203 | ||
| Organism | Staphylococcus aureus strain 2022QW-00133 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PQQ74_RS10365 | Protein ID | WP_000621175.1 |
| Coordinates | 2093700..2094062 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | PQQ74_RS10370 | Protein ID | WP_000948331.1 |
| Coordinates | 2094059..2094229 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ74_RS10345 (2090679) | 2090679..2091449 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
| PQQ74_RS10350 (2091424) | 2091424..2091903 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| PQQ74_RS10355 (2091905) | 2091905..2092231 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| PQQ74_RS10360 (2092350) | 2092350..2093351 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| PQQ74_RS10365 (2093700) | 2093700..2094062 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PQQ74_RS10370 (2094059) | 2094059..2094229 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PQQ74_RS10375 (2094314) | 2094314..2095462 | - | 1149 | WP_001281145.1 | alanine racemase | - |
| PQQ74_RS10380 (2095528) | 2095528..2095887 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
| PQQ74_RS10385 (2095891) | 2095891..2096382 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
| PQQ74_RS10390 (2096369) | 2096369..2097952 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| PQQ74_RS10395 (2097945) | 2097945..2098424 | - | 480 | WP_001287088.1 | hypothetical protein | - |
| PQQ74_RS10400 (2098632) | 2098632..2099192 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T270087 WP_000621175.1 NZ_CP117203:c2094062-2093700 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|