Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1893001..1893777 | Replicon | chromosome |
| Accession | NZ_CP117203 | ||
| Organism | Staphylococcus aureus strain 2022QW-00133 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | PQQ74_RS09090 | Protein ID | WP_000031108.1 |
| Coordinates | 1893001..1893153 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | PQQ74_RS09095 | Protein ID | WP_001251224.1 |
| Coordinates | 1893178..1893777 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ74_RS09075 (1888964) | 1888964..1889785 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
| PQQ74_RS09080 (1890248) | 1890248..1891633 | - | 1386 | WP_000116224.1 | class II fumarate hydratase | - |
| PQQ74_RS09085 (1891829) | 1891829..1892224 | - | 396 | WP_000901021.1 | hypothetical protein | - |
| PQQ74_RS09090 (1893001) | 1893001..1893153 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| PQQ74_RS09095 (1893178) | 1893178..1893777 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| PQQ74_RS09100 (1893936) | 1893936..1894406 | - | 471 | WP_000181398.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| PQQ74_RS09105 (1894411) | 1894411..1895538 | - | 1128 | WP_000379978.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| PQQ74_RS09110 (1895689) | 1895689..1896412 | - | 724 | Protein_1784 | amino acid ABC transporter ATP-binding protein | - |
| PQQ74_RS09115 (1896405) | 1896405..1897862 | - | 1458 | WP_000649907.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T270083 WP_000031108.1 NZ_CP117203:c1893153-1893001 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT270083 WP_001251224.1 NZ_CP117203:c1893777-1893178 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|