Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 355964..356559 | Replicon | plasmid unnamed1 |
Accession | NZ_CP117200 | ||
Organism | Pantoea sp. SS70 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | PO881_RS21255 | Protein ID | WP_271460590.1 |
Coordinates | 355964..356341 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | PO881_RS21260 | Protein ID | WP_110867236.1 |
Coordinates | 356338..356559 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO881_RS21235 (PO881_21235) | 352564..353877 | + | 1314 | WP_280173283.1 | cytochrome c | - |
PO881_RS21240 (PO881_21240) | 353988..354452 | - | 465 | WP_210080080.1 | heme-degrading domain-containing protein | - |
PO881_RS21245 (PO881_21245) | 354535..354885 | - | 351 | WP_192414734.1 | cupin domain-containing protein | - |
PO881_RS21250 (PO881_21250) | 355031..355954 | + | 924 | WP_280173284.1 | glutaminase B | - |
PO881_RS21255 (PO881_21255) | 355964..356341 | - | 378 | WP_271460590.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PO881_RS21260 (PO881_21260) | 356338..356559 | - | 222 | WP_110867236.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
PO881_RS21265 (PO881_21265) | 356806..357222 | + | 417 | WP_137387179.1 | DUF2946 domain-containing protein | - |
PO881_RS21270 (PO881_21270) | 357295..359031 | + | 1737 | WP_280173285.1 | DUF2534 family protein | - |
PO881_RS21275 (PO881_21275) | 359112..360128 | - | 1017 | WP_008108001.1 | NAD(P)-dependent alcohol dehydrogenase | - |
PO881_RS21280 (PO881_21280) | 360251..360520 | - | 270 | WP_101761136.1 | hypothetical protein | - |
PO881_RS21285 (PO881_21285) | 360800..361360 | + | 561 | WP_217547695.1 | thioredoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | hcp/tssD | 1..779368 | 779368 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13948.02 Da Isoelectric Point: 6.9889
>T270077 WP_271460590.1 NZ_CP117200:c356341-355964 [Pantoea sp. SS70]
MIHVSAEEVIALHDYLLKRYAGVAGMSDPGRAEAIVARVINREYYEGIQDIFELAATYWVAISRGHIFADANKRTSLNVT
MLFLKRNGIRVHDRPELVELTVMAATGEAGVPYLANQLRAFFGSH
MIHVSAEEVIALHDYLLKRYAGVAGMSDPGRAEAIVARVINREYYEGIQDIFELAATYWVAISRGHIFADANKRTSLNVT
MLFLKRNGIRVHDRPELVELTVMAATGEAGVPYLANQLRAFFGSH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|