Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 343141..343691 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP117200 | ||
| Organism | Pantoea sp. SS70 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | PO881_RS21190 | Protein ID | WP_101761119.1 |
| Coordinates | 343383..343691 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | PO881_RS21185 | Protein ID | WP_192413436.1 |
| Coordinates | 343141..343380 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO881_RS21165 (PO881_21165) | 338913..340079 | + | 1167 | WP_280173278.1 | lycopene beta-cyclase CrtY | - |
| PO881_RS21170 (PO881_21170) | 340076..341557 | + | 1482 | WP_192413424.1 | phytoene desaturase | - |
| PO881_RS21175 (PO881_21175) | 341554..342483 | + | 930 | WP_280173279.1 | phytoene/squalene synthase family protein | - |
| PO881_RS21180 (PO881_21180) | 342422..342955 | - | 534 | WP_210080072.1 | sterol desaturase family protein | - |
| PO881_RS21185 (PO881_21185) | 343141..343380 | + | 240 | WP_192413436.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| PO881_RS21190 (PO881_21190) | 343383..343691 | + | 309 | WP_101761119.1 | CcdB family protein | Toxin |
| PO881_RS21195 (PO881_21195) | 343823..345013 | + | 1191 | WP_280173280.1 | MFS transporter | - |
| PO881_RS21200 (PO881_21200) | 345006..345350 | - | 345 | WP_280173281.1 | helix-turn-helix transcriptional regulator | - |
| PO881_RS21205 (PO881_21205) | 345447..346388 | - | 942 | WP_192413442.1 | sugar phosphate isomerase/epimerase | - |
| PO881_RS21210 (PO881_21210) | 346397..347575 | - | 1179 | WP_110867019.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hcp/tssD | 1..779368 | 779368 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 12049.95 Da Isoelectric Point: 7.0106
>T270076 WP_101761119.1 NZ_CP117200:343383-343691 [Pantoea sp. SS70]
MQYFIYRNTNRNSEYPYLVDVQSEIIGELASRIVIPLYPLKQFKKKQVERLNPVIKVEGEEFLVMTHEMASVRVSLLGDQ
VMDARVYRQRIKDSVDFVFDGF
MQYFIYRNTNRNSEYPYLVDVQSEIIGELASRIVIPLYPLKQFKKKQVERLNPVIKVEGEEFLVMTHEMASVRVSLLGDQ
VMDARVYRQRIKDSVDFVFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|