Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH |
| Location | 131489..132191 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP117200 | ||
| Organism | Pantoea sp. SS70 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PO881_RS20195 | Protein ID | WP_280173185.1 |
| Coordinates | 131808..132191 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PO881_RS20190 | Protein ID | WP_101761582.1 |
| Coordinates | 131489..131815 (-) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO881_RS20170 (PO881_20170) | 127201..128088 | + | 888 | WP_192413124.1 | aromatic amino acid DMT transporter YddG | - |
| PO881_RS20175 (PO881_20175) | 128248..129450 | - | 1203 | WP_192413126.1 | FAD-dependent oxidoreductase | - |
| PO881_RS20180 (PO881_20180) | 129505..130440 | - | 936 | WP_192413128.1 | AraC family transcriptional regulator | - |
| PO881_RS20185 (PO881_20185) | 130553..131386 | + | 834 | WP_192413130.1 | oxidoreductase | - |
| PO881_RS20190 (PO881_20190) | 131489..131815 | - | 327 | WP_101761582.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PO881_RS20195 (PO881_20195) | 131808..132191 | - | 384 | WP_280173185.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PO881_RS20200 (PO881_20200) | 132466..132717 | + | 252 | WP_110866812.1 | regulatory protein YcgZ | - |
| PO881_RS20205 (PO881_20205) | 132835..133125 | + | 291 | WP_101761585.1 | hypothetical protein | - |
| PO881_RS20210 (PO881_20210) | 133325..133675 | - | 351 | WP_008102074.1 | DUF3147 family protein | - |
| PO881_RS20215 (PO881_20215) | 133702..134565 | - | 864 | WP_280173186.1 | substrate-binding domain-containing protein | - |
| PO881_RS20220 (PO881_20220) | 134746..135141 | + | 396 | WP_192413135.1 | VOC family protein | - |
| PO881_RS20225 (PO881_20225) | 135254..135607 | - | 354 | WP_192234707.1 | DUF1428 domain-containing protein | - |
| PO881_RS20230 (PO881_20230) | 135786..136472 | + | 687 | WP_110866982.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hcp/tssD | 1..779368 | 779368 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13849.17 Da Isoelectric Point: 10.2844
>T270073 WP_280173185.1 NZ_CP117200:c132191-131808 [Pantoea sp. SS70]
MAIYVLKPFDRNTKGDAINSAKLCKAALEVMAGIYEASFGRGVYKKRIPLVAGKSGGARAVVAFKTEKHLFFVNGYAKSA
FKSSGREISESDLALYKEVAKQLFEMTSEKAKVAINTGKMREVKCDG
MAIYVLKPFDRNTKGDAINSAKLCKAALEVMAGIYEASFGRGVYKKRIPLVAGKSGGARAVVAFKTEKHLFFVNGYAKSA
FKSSGREISESDLALYKEVAKQLFEMTSEKAKVAINTGKMREVKCDG
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|