Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 3598030..3598699 | Replicon | chromosome |
Accession | NZ_CP117199 | ||
Organism | Pantoea sp. SS70 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | PO881_RS16485 | Protein ID | WP_280172099.1 |
Coordinates | 3598030..3598359 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | PO881_RS16490 | Protein ID | WP_280172100.1 |
Coordinates | 3598382..3598699 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO881_RS16460 (PO881_16460) | 3594699..3595214 | - | 516 | WP_101762980.1 | G/U mismatch-specific DNA glycosylase | - |
PO881_RS16465 (PO881_16465) | 3595211..3595798 | - | 588 | WP_110867321.1 | TetR/AcrR family transcriptional regulator | - |
PO881_RS16470 (PO881_16470) | 3595933..3596715 | + | 783 | WP_280172097.1 | SDR family oxidoreductase | - |
PO881_RS16480 (PO881_16480) | 3597081..3597914 | - | 834 | WP_280172098.1 | DUF4942 domain-containing protein | - |
PO881_RS16485 (PO881_16485) | 3598030..3598359 | - | 330 | WP_280172099.1 | TA system toxin CbtA family protein | Toxin |
PO881_RS16490 (PO881_16490) | 3598382..3598699 | - | 318 | WP_280172100.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PO881_RS16495 (PO881_16495) | 3598712..3599188 | - | 477 | WP_280172101.1 | DNA repair protein RadC | - |
PO881_RS16500 (PO881_16500) | 3599203..3599616 | - | 414 | WP_280172917.1 | antirestriction protein | - |
PO881_RS16505 (PO881_16505) | 3599741..3600148 | - | 408 | WP_280172918.1 | IrmA family protein | - |
PO881_RS16510 (PO881_16510) | 3600178..3600627 | - | 450 | WP_280172102.1 | hypothetical protein | - |
PO881_RS16515 (PO881_16515) | 3600643..3601272 | - | 630 | WP_280172103.1 | hypothetical protein | - |
PO881_RS16520 (PO881_16520) | 3601269..3601985 | - | 717 | WP_280172104.1 | WYL domain-containing protein | - |
PO881_RS16525 (PO881_16525) | 3602192..3603028 | - | 837 | WP_280172105.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3598030..3616929 | 18899 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11957.59 Da Isoelectric Point: 4.4315
>T270071 WP_280172099.1 NZ_CP117199:c3598359-3598030 [Pantoea sp. SS70]
MPTFSSHPERAASCCLSPTAHWRILLVYLLEKLFGLELNDTPFCSESVIQQHIEAGVTLVDAINFLVEKYDLVRVDTSSD
ACTESEIFLTAADILKASHATGLTQSNLS
MPTFSSHPERAASCCLSPTAHWRILLVYLLEKLFGLELNDTPFCSESVIQQHIEAGVTLVDAINFLVEKYDLVRVDTSSD
ACTESEIFLTAADILKASHATGLTQSNLS
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|