Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2712113..2712744 | Replicon | chromosome |
Accession | NZ_CP117199 | ||
Organism | Pantoea sp. SS70 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PO881_RS12550 | Protein ID | WP_061717750.1 |
Coordinates | 2712346..2712744 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PO881_RS12545 | Protein ID | WP_101763423.1 |
Coordinates | 2712113..2712346 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO881_RS12540 (PO881_12540) | 2708970..2712041 | + | 3072 | WP_280171870.1 | multidrug efflux RND transporter permease subunit MdtC | - |
PO881_RS12545 (PO881_12545) | 2712113..2712346 | + | 234 | WP_101763423.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PO881_RS12550 (PO881_12550) | 2712346..2712744 | + | 399 | WP_061717750.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PO881_RS12555 (PO881_12555) | 2712761..2714167 | + | 1407 | WP_280171871.1 | multidrug transporter subunit MdtD | - |
PO881_RS12560 (PO881_12560) | 2714164..2715549 | + | 1386 | WP_101763347.1 | two-component system sensor histidine kinase BaeS | - |
PO881_RS12565 (PO881_12565) | 2715559..2716266 | + | 708 | WP_101763346.1 | two-component system response regulator BaeR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15025.28 Da Isoelectric Point: 8.0933
>T270070 WP_061717750.1 NZ_CP117199:2712346-2712744 [Pantoea sp. SS70]
MHRYMLDTNIVIYVIKRRPIEVLERFNANVGRMVISTITLAELFHGSEKSAFPERNLRTVEDFVSRLDVLNYDAKAAFHY
GAIRAELEKNGTPIGLNDLHIAAHARSAALTLVSNNLREFSRVNGLICENWI
MHRYMLDTNIVIYVIKRRPIEVLERFNANVGRMVISTITLAELFHGSEKSAFPERNLRTVEDFVSRLDVLNYDAKAAFHY
GAIRAELEKNGTPIGLNDLHIAAHARSAALTLVSNNLREFSRVNGLICENWI
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|