Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2626749..2627368 | Replicon | chromosome |
| Accession | NZ_CP117199 | ||
| Organism | Pantoea sp. SS70 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PO881_RS12210 | Protein ID | WP_280171844.1 |
| Coordinates | 2627180..2627368 (-) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PO881_RS12205 | Protein ID | WP_101763410.1 |
| Coordinates | 2626749..2627162 (-) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO881_RS12185 (PO881_12185) | 2622676..2623503 | - | 828 | WP_192233450.1 | MetQ/NlpA family lipoprotein | - |
| PO881_RS12190 (PO881_12190) | 2623718..2624359 | + | 642 | WP_271460770.1 | TetR family transcriptional regulator | - |
| PO881_RS12195 (PO881_12195) | 2624434..2625816 | + | 1383 | WP_137386084.1 | D-arabinono-1,4-lactone oxidase | - |
| PO881_RS12200 (PO881_12200) | 2625835..2626662 | + | 828 | WP_061717669.1 | glycosyltransferase family 8 protein | - |
| PO881_RS12205 (PO881_12205) | 2626749..2627162 | - | 414 | WP_101763410.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PO881_RS12210 (PO881_12210) | 2627180..2627368 | - | 189 | WP_280171844.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PO881_RS12215 (PO881_12215) | 2627510..2627830 | - | 321 | WP_008110563.1 | PTS system regulator TmaR | - |
| PO881_RS12220 (PO881_12220) | 2627992..2629050 | - | 1059 | WP_101763409.1 | FUSC family protein | - |
| PO881_RS12225 (PO881_12225) | 2629359..2630525 | - | 1167 | WP_192233442.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| PO881_RS12230 (PO881_12230) | 2630728..2632149 | + | 1422 | WP_110866679.1 | exodeoxyribonuclease I | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6985.20 Da Isoelectric Point: 11.0007
>T270069 WP_280171844.1 NZ_CP117199:c2627368-2627180 [Pantoea sp. SS70]
MDSRSLMAEIKADGWELIRVNGSHHHFVHPVKKGLVTIPHPKKDLPIKTVKSNRKQAGLTVH
MDSRSLMAEIKADGWELIRVNGSHHHFVHPVKKGLVTIPHPKKDLPIKTVKSNRKQAGLTVH
Download Length: 189 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 14914.23 Da Isoelectric Point: 4.5951
>AT270069 WP_101763410.1 NZ_CP117199:c2627162-2626749 [Pantoea sp. SS70]
MFYPIAIEAGDQSTAFGVTVPDLPGCFSAGDTLEAAVTNAKEAIIGHLELLVELEQDIPAVSELKSLMKDPQYAGYVWVL
IDVDVTRILGGSEKINVTLPKLLIDRIDRCVATHPEFKTRSGFLAQVALERIAKTRS
MFYPIAIEAGDQSTAFGVTVPDLPGCFSAGDTLEAAVTNAKEAIIGHLELLVELEQDIPAVSELKSLMKDPQYAGYVWVL
IDVDVTRILGGSEKINVTLPKLLIDRIDRCVATHPEFKTRSGFLAQVALERIAKTRS
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|