Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2617275..2617865 | Replicon | chromosome |
Accession | NZ_CP117199 | ||
Organism | Pantoea sp. SS70 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | PO881_RS12155 | Protein ID | WP_277973770.1 |
Coordinates | 2617275..2617607 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | PO881_RS12160 | Protein ID | WP_075808466.1 |
Coordinates | 2617608..2617865 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO881_RS12135 (PO881_12135) | 2612436..2613467 | - | 1032 | WP_101763421.1 | ABC transporter permease | - |
PO881_RS12140 (PO881_12140) | 2613482..2614966 | - | 1485 | WP_101763420.1 | sugar ABC transporter ATP-binding protein | - |
PO881_RS12145 (PO881_12145) | 2615000..2615923 | - | 924 | WP_101763419.1 | sugar ABC transporter substrate-binding protein | - |
PO881_RS12155 (PO881_12155) | 2617275..2617607 | - | 333 | WP_277973770.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PO881_RS12160 (PO881_12160) | 2617608..2617865 | - | 258 | WP_075808466.1 | antitoxin | Antitoxin |
PO881_RS12165 (PO881_12165) | 2618283..2619587 | - | 1305 | WP_280171841.1 | NtaA/DmoA family FMN-dependent monooxygenase | - |
PO881_RS12170 (PO881_12170) | 2619599..2620798 | - | 1200 | WP_280171842.1 | M20 family metallopeptidase | - |
PO881_RS12175 (PO881_12175) | 2620896..2621552 | - | 657 | WP_192233454.1 | methionine ABC transporter permease | - |
PO881_RS12180 (PO881_12180) | 2621533..2622663 | - | 1131 | WP_280171843.1 | ATP-binding cassette domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11782.57 Da Isoelectric Point: 9.3417
>T270068 WP_277973770.1 NZ_CP117199:c2617607-2617275 [Pantoea sp. SS70]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNTLTRLPVVVPVTSGGNFAREAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNTLTRLPVVVPVTSGGNFAREAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|