Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1087332..1087952 Replicon chromosome
Accession NZ_CP117199
Organism Pantoea sp. SS70

Toxin (Protein)


Gene name Hha Uniprot ID J2UI73
Locus tag PO881_RS04895 Protein ID WP_007886938.1
Coordinates 1087332..1087550 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J3DFW0
Locus tag PO881_RS04900 Protein ID WP_007886936.1
Coordinates 1087575..1087952 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO881_RS04865 (PO881_04865) 1083111..1083449 + 339 WP_007886947.1 P-II family nitrogen regulator -
PO881_RS04870 (PO881_04870) 1083483..1084772 + 1290 WP_101762414.1 ammonium transporter AmtB -
PO881_RS04875 (PO881_04875) 1084845..1085708 - 864 WP_192236701.1 acyl-CoA thioesterase II -
PO881_RS04880 (PO881_04880) 1085914..1086471 + 558 WP_110867736.1 YbaY family lipoprotein -
PO881_RS04885 (PO881_04885) 1086617..1086928 - 312 WP_008103902.1 MGMT family protein -
PO881_RS04895 (PO881_04895) 1087332..1087550 - 219 WP_007886938.1 HHA domain-containing protein Toxin
PO881_RS04900 (PO881_04900) 1087575..1087952 - 378 WP_007886936.1 Hha toxicity modulator TomB Antitoxin
PO881_RS04905 (PO881_04905) 1088100..1088453 - 354 WP_101762410.1 hypothetical protein -
PO881_RS04910 (PO881_04910) 1088794..1089450 + 657 WP_280172532.1 ABC transporter ATP-binding protein -
PO881_RS04915 (PO881_04915) 1089447..1090286 + 840 WP_101762408.1 metal ABC transporter permease -
PO881_RS04920 (PO881_04920) 1090309..1091187 + 879 WP_280172533.1 metal ABC transporter substrate-binding protein -
PO881_RS04925 (PO881_04925) 1091232..1091372 - 141 WP_008103894.1 type B 50S ribosomal protein L36 -
PO881_RS04930 (PO881_04930) 1091388..1091645 - 258 WP_101762406.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8594.98 Da        Isoelectric Point: 9.5023

>T270067 WP_007886938.1 NZ_CP117199:c1087550-1087332 [Pantoea sp. SS70]
MSNQALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDNELAVFYSAADHRLAELTMNKLYDKVPVSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14743.36 Da        Isoelectric Point: 4.4069

>AT270067 WP_007886936.1 NZ_CP117199:c1087952-1087575 [Pantoea sp. SS70]
MDEYSPKRHDIAQLKYLCENLFDESMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2M9WAL0

Antitoxin

Source ID Structure
AlphaFold DB J3DFW0

References