Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 389820..390513 | Replicon | chromosome |
Accession | NZ_CP117199 | ||
Organism | Pantoea sp. SS70 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PO881_RS01740 | Protein ID | WP_222234556.1 |
Coordinates | 389820..389996 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PO881_RS01745 | Protein ID | WP_101763040.1 |
Coordinates | 390109..390513 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO881_RS01725 (PO881_01725) | 385300..385626 | - | 327 | WP_008109989.1 | DUF485 domain-containing protein | - |
PO881_RS01730 (PO881_01730) | 385773..387728 | - | 1956 | WP_280172350.1 | acetate--CoA ligase | - |
PO881_RS01735 (PO881_01735) | 388310..389611 | + | 1302 | WP_007888562.1 | glutamate/aspartate:proton symporter GltP | - |
PO881_RS01740 (PO881_01740) | 389820..389996 | + | 177 | WP_222234556.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PO881_RS01745 (PO881_01745) | 390109..390513 | + | 405 | WP_101763040.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PO881_RS01750 (PO881_01750) | 390654..391565 | + | 912 | WP_277974407.1 | N-acetylmuramic acid 6-phosphate etherase | - |
PO881_RS01755 (PO881_01755) | 391565..392995 | + | 1431 | WP_101763038.1 | PTS N-acetylmuramic acid transporter subunit IIBC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6863.13 Da Isoelectric Point: 10.9513
>T270066 WP_222234556.1 NZ_CP117199:389820-389996 [Pantoea sp. SS70]
MSSRELIRMLLERGWVLDRVKGSHHVFVRRDKPYHISLPHPEKDLATGTVRKLIKLMD
MSSRELIRMLLERGWVLDRVKGSHHVFVRRDKPYHISLPHPEKDLATGTVRKLIKLMD
Download Length: 177 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14751.29 Da Isoelectric Point: 4.4077
>AT270066 WP_101763040.1 NZ_CP117199:390109-390513 [Pantoea sp. SS70]
MRFPVYLHKTESNTYSGFVPDVVGCFFAGETVDDALTDASAAIDSHVESSTDAGYEVPVATNIETHIEDENCQGGYWAFV
DIDLSRYEGKAVKLNITLPQNLLTKIDSYVDHHREYGSRSGFLAALARKELANA
MRFPVYLHKTESNTYSGFVPDVVGCFFAGETVDDALTDASAAIDSHVESSTDAGYEVPVATNIETHIEDENCQGGYWAFV
DIDLSRYEGKAVKLNITLPQNLLTKIDSYVDHHREYGSRSGFLAALARKELANA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|