Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1291780..1292697 | Replicon | chromosome |
| Accession | NZ_CP117197 | ||
| Organism | Bacillus velezensis strain 3ZT | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | I2HQ15 |
| Locus tag | PO847_RS06815 | Protein ID | WP_007407256.1 |
| Coordinates | 1291951..1292697 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | I2HQ14 |
| Locus tag | PO847_RS06810 | Protein ID | WP_003154807.1 |
| Coordinates | 1291780..1291950 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO847_RS06770 (1287013) | 1287013..1288635 | + | 1623 | WP_022553476.1 | pyocin knob domain-containing protein | - |
| PO847_RS06775 (1288648) | 1288648..1289019 | + | 372 | WP_022553475.1 | XkdW family protein | - |
| PO847_RS06780 (1289024) | 1289024..1289221 | + | 198 | WP_007610833.1 | XkdX family protein | - |
| PO847_RS06785 (1289278) | 1289278..1290039 | + | 762 | WP_022553474.1 | hypothetical protein | - |
| PO847_RS06790 (1290091) | 1290091..1290354 | + | 264 | WP_022553473.1 | hemolysin XhlA family protein | - |
| PO847_RS06795 (1290368) | 1290368..1290631 | + | 264 | WP_003154813.1 | phage holin | - |
| PO847_RS06800 (1290645) | 1290645..1291523 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
| PO847_RS06805 (1291558) | 1291558..1291683 | - | 126 | WP_003154809.1 | hypothetical protein | - |
| PO847_RS06810 (1291780) | 1291780..1291950 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
| PO847_RS06815 (1291951) | 1291951..1292697 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| PO847_RS06820 (1292802) | 1292802..1293800 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
| PO847_RS06825 (1293813) | 1293813..1294430 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
| PO847_RS06830 (1294716) | 1294716..1296032 | - | 1317 | WP_007610842.1 | amino acid permease | - |
| PO847_RS06835 (1296354) | 1296354..1297304 | + | 951 | WP_022553472.1 | ring-cleaving dioxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1258070..1339197 | 81127 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T270064 WP_007407256.1 NZ_CP117197:c1292697-1291951 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|