Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 485980..486617 | Replicon | chromosome |
Accession | NZ_CP117197 | ||
Organism | Bacillus velezensis strain 3ZT |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PO847_RS02465 | Protein ID | WP_003156187.1 |
Coordinates | 486267..486617 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | PO847_RS02460 | Protein ID | WP_003156188.1 |
Coordinates | 485980..486261 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO847_RS02440 (482345) | 482345..482944 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
PO847_RS02445 (483037) | 483037..483402 | + | 366 | WP_022552632.1 | holo-ACP synthase | - |
PO847_RS02450 (483567) | 483567..484574 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
PO847_RS02455 (484691) | 484691..485860 | + | 1170 | WP_022552633.1 | alanine racemase | - |
PO847_RS02460 (485980) | 485980..486261 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PO847_RS02465 (486267) | 486267..486617 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PO847_RS02470 (486735) | 486735..487556 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
PO847_RS02475 (487561) | 487561..487926 | + | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
PO847_RS02480 (487929) | 487929..488330 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
PO847_RS02485 (488342) | 488342..489349 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
PO847_RS02490 (489413) | 489413..489742 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
PO847_RS02495 (489739) | 489739..490221 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
PO847_RS02500 (490187) | 490187..490975 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
PO847_RS02505 (490975) | 490975..491577 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T270063 WP_003156187.1 NZ_CP117197:486267-486617 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|