Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 916648..917222 | Replicon | chromosome |
| Accession | NZ_CP117196 | ||
| Organism | Pasteurella multocida strain P2237 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A849CFF7 |
| Locus tag | M9D40_RS04370 | Protein ID | WP_014667974.1 |
| Coordinates | 916938..917222 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A849CG04 |
| Locus tag | M9D40_RS04365 | Protein ID | WP_014391174.1 |
| Coordinates | 916648..916941 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9D40_RS04345 (M9D40_004345) | 911814..912905 | - | 1092 | WP_005756839.1 | L-ascorbate 6-phosphate lactonase | - |
| M9D40_RS04350 (M9D40_004350) | 913254..915044 | + | 1791 | WP_014391171.1 | PTS ascorbate-specific subunit IIBC | - |
| M9D40_RS04355 (M9D40_004355) | 915089..915556 | + | 468 | WP_014391172.1 | PTS sugar transporter subunit IIA | - |
| M9D40_RS04360 (M9D40_004360) | 915574..916251 | + | 678 | WP_014391173.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
| M9D40_RS04365 (M9D40_004365) | 916648..916941 | - | 294 | WP_014391174.1 | putative addiction module antidote protein | Antitoxin |
| M9D40_RS04370 (M9D40_004370) | 916938..917222 | - | 285 | WP_014667974.1 | addiction module protein | Toxin |
| M9D40_RS04380 (M9D40_004380) | 918516..918777 | - | 262 | Protein_837 | hypothetical protein | - |
| M9D40_RS04385 (M9D40_004385) | 919121..919273 | - | 153 | WP_014391177.1 | hypothetical protein | - |
| M9D40_RS04390 (M9D40_004390) | 919573..921759 | - | 2187 | WP_014667973.1 | S8 family peptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 918516..918677 | 161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10702.41 Da Isoelectric Point: 10.2849
>T270061 WP_014667974.1 NZ_CP117196:c917222-916938 [Pasteurella multocida]
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A849CFF7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A849CG04 |