Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 41405..42000 Replicon plasmid pEP1
Accession NZ_CP117194
Organism Acidovorax temperans strain LMJ

Toxin (Protein)


Gene name vapC Uniprot ID A0A543KTE7
Locus tag PQV96_RS21335 Protein ID WP_066695287.1
Coordinates 41405..41809 (-) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag PQV96_RS21340 Protein ID WP_066695288.1
Coordinates 41818..42000 (-) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQV96_RS21295 (PQV96_21295) 36739..37152 - 414 WP_142085862.1 IS200/IS605 family transposase -
PQV96_RS21300 (PQV96_21300) 37175..38263 + 1089 WP_273625368.1 transposase -
PQV96_RS21305 (PQV96_21305) 38876..39571 - 696 WP_273625369.1 hypothetical protein -
PQV96_RS21310 (PQV96_21310) 39607..39924 - 318 WP_273625370.1 hypothetical protein -
PQV96_RS21315 (PQV96_21315) 39947..40546 - 600 WP_066695294.1 hypothetical protein -
PQV96_RS21320 (PQV96_21320) 40562..40717 - 156 WP_156445112.1 hypothetical protein -
PQV96_RS21325 (PQV96_21325) 40841..41095 - 255 WP_066786278.1 hypothetical protein -
PQV96_RS21330 (PQV96_21330) 41105..41398 - 294 WP_156445191.1 hypothetical protein -
PQV96_RS21335 (PQV96_21335) 41405..41809 - 405 WP_066695287.1 type II toxin-antitoxin system VapC family toxin Toxin
PQV96_RS21340 (PQV96_21340) 41818..42000 - 183 WP_066695288.1 hypothetical protein Antitoxin
PQV96_RS21345 (PQV96_21345) 42120..42272 - 153 WP_170207438.1 hypothetical protein -
PQV96_RS21350 (PQV96_21350) 42340..42735 - 396 WP_003049909.1 type II toxin-antitoxin system VapC family toxin -
PQV96_RS21355 (PQV96_21355) 42732..42974 - 243 WP_066695292.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
PQV96_RS21360 (PQV96_21360) 43771..45057 - 1287 Protein_49 IS21 family transposase -
PQV96_RS21365 (PQV96_21365) 45146..46654 - 1509 WP_273625371.1 IS21 family transposase -
PQV96_RS21370 (PQV96_21370) 46755..46967 - 213 WP_273625372.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..187379 187379


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-125)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 14669.06 Da        Isoelectric Point: 9.6276

>T270060 WP_066695287.1 NZ_CP117194:c41809-41405 [Acidovorax temperans]
MFMLDTDTCIFLMRGESQTLAVKVQSVPLQQQVMSAVTFAELTYGVQASAVAKRKQNQAVLDSLALHLAVLDWPQEAAKH
YAEIRADLKKRGAQLGAADLMIAAHARAMGAVIVTNNVKDFGRVKGLQVENWTK

Download         Length: 405 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 7003.96 Da        Isoelectric Point: 4.6509

>AT270060 WP_066695288.1 NZ_CP117194:c42000-41818 [Acidovorax temperans]
MPLEYRFPESVREVFIRRDGESVVLTPRPSDWSGFFASGMKASTDFMADIERMPIQERSF

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A543KTE7

Antitoxin

Source ID Structure

References