Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4585041..4585801 | Replicon | chromosome |
Accession | NZ_CP117184 | ||
Organism | Salmonella enterica subsp. enterica strain 123 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | Q57IH1 |
Locus tag | PQ453_RS22690 | Protein ID | WP_000533909.1 |
Coordinates | 4585041..4585526 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | M7RHS4 |
Locus tag | PQ453_RS22695 | Protein ID | WP_000965886.1 |
Coordinates | 4585514..4585801 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQ453_RS22660 (4580111) | 4580111..4580773 | + | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
PQ453_RS22665 (4580992) | 4580992..4581966 | + | 975 | WP_000804674.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
PQ453_RS22670 (4582016) | 4582016..4582726 | - | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
PQ453_RS22675 (4583165) | 4583165..4583455 | + | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
PQ453_RS22680 (4583744) | 4583744..4583956 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
PQ453_RS22685 (4584130) | 4584130..4584669 | + | 540 | WP_000047149.1 | copper-binding periplasmic metallochaperone CueP | - |
PQ453_RS22690 (4585041) | 4585041..4585526 | - | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
PQ453_RS22695 (4585514) | 4585514..4585801 | - | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
PQ453_RS22700 (4585979) | 4585979..4586446 | - | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
PQ453_RS22705 (4586618) | 4586618..4586893 | - | 276 | Protein_4433 | IS3 family transposase | - |
PQ453_RS22710 (4587075) | 4587075..4589144 | - | 2070 | WP_001291736.1 | glycine--tRNA ligase subunit beta | - |
PQ453_RS22715 (4589154) | 4589154..4590065 | - | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
PQ453_RS22720 (4590204) | 4590204..4590506 | - | 303 | WP_000605590.1 | YsaB family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T270055 WP_000533909.1 NZ_CP117184:c4585526-4585041 [Salmonella enterica subsp. enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7F36 | |
PDB | 7AK8 | |
PDB | 5FVJ |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V2JDX2 |