Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3872716..3873376 | Replicon | chromosome |
Accession | NZ_CP117184 | ||
Organism | Salmonella enterica subsp. enterica strain 123 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | PQ453_RS19175 | Protein ID | WP_000244756.1 |
Coordinates | 3872716..3873129 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | PQ453_RS19180 | Protein ID | WP_000351186.1 |
Coordinates | 3873110..3873376 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQ453_RS19155 (3868657) | 3868657..3870390 | - | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PQ453_RS19160 (3870396) | 3870396..3871109 | - | 714 | WP_000745625.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PQ453_RS19165 (3871133) | 3871133..3872029 | - | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
PQ453_RS19170 (3872142) | 3872142..3872663 | + | 522 | WP_001055885.1 | flavodoxin FldB | - |
PQ453_RS19175 (3872716) | 3872716..3873129 | - | 414 | WP_000244756.1 | protein YgfX | Toxin |
PQ453_RS19180 (3873110) | 3873110..3873376 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
PQ453_RS19185 (3873626) | 3873626..3874606 | + | 981 | WP_000874172.1 | tRNA-modifying protein YgfZ | - |
PQ453_RS19190 (3874722) | 3874722..3875381 | - | 660 | WP_000250289.1 | hemolysin III family protein | - |
PQ453_RS19195 (3875545) | 3875545..3875856 | - | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
PQ453_RS19200 (3876015) | 3876015..3877448 | + | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T270052 WP_000244756.1 NZ_CP117184:c3873129-3872716 [Salmonella enterica subsp. enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |