Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2289732..2290254 | Replicon | chromosome |
Accession | NZ_CP117184 | ||
Organism | Salmonella enterica subsp. enterica strain 123 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | PQ453_RS11300 | Protein ID | WP_000221343.1 |
Coordinates | 2289732..2290016 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQ453_RS11305 | Protein ID | WP_000885424.1 |
Coordinates | 2290006..2290254 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQ453_RS11280 (2285807) | 2285807..2287315 | - | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
PQ453_RS11285 (2287360) | 2287360..2287848 | + | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQ453_RS11290 (2288041) | 2288041..2289120 | + | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQ453_RS11295 (2289172) | 2289172..2289561 | - | 390 | WP_000194089.1 | RidA family protein | - |
PQ453_RS11300 (2289732) | 2289732..2290016 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQ453_RS11305 (2290006) | 2290006..2290254 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQ453_RS11310 (2290406) | 2290406..2290621 | + | 216 | WP_000206207.1 | hypothetical protein | - |
PQ453_RS11315 (2290611) | 2290611..2290943 | + | 333 | WP_000253154.1 | DUF1493 family protein | - |
PQ453_RS11320 (2291086) | 2291086..2291994 | + | 909 | WP_010989018.1 | hypothetical protein | - |
PQ453_RS11325 (2292050) | 2292050..2292764 | - | 715 | Protein_2208 | helix-turn-helix domain-containing protein | - |
PQ453_RS11330 (2293572) | 2293572..2295038 | - | 1467 | WP_000987828.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T270045 WP_000221343.1 NZ_CP117184:c2290016-2289732 [Salmonella enterica subsp. enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |