Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1241553..1242173 | Replicon | chromosome |
Accession | NZ_CP117184 | ||
Organism | Salmonella enterica subsp. enterica strain 123 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQ453_RS06025 | Protein ID | WP_001280991.1 |
Coordinates | 1241553..1241771 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQ453_RS06030 | Protein ID | WP_000344807.1 |
Coordinates | 1241799..1242173 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQ453_RS05985 (1236777) | 1236777..1237346 | + | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
PQ453_RS05990 (1237379) | 1237379..1237768 | - | 390 | WP_000961285.1 | MGMT family protein | - |
PQ453_RS06000 (1237999) | 1237999..1239549 | - | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
PQ453_RS06005 (1239774) | 1239774..1240034 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQ453_RS06010 (1240040) | 1240040..1240180 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQ453_RS06015 (1240236) | 1240236..1240706 | - | 471 | WP_000136181.1 | YlaC family protein | - |
PQ453_RS06020 (1240823) | 1240823..1241374 | - | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
PQ453_RS06025 (1241553) | 1241553..1241771 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQ453_RS06030 (1241799) | 1241799..1242173 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQ453_RS06035 (1242669) | 1242669..1245818 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQ453_RS06040 (1245841) | 1245841..1247034 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270044 WP_001280991.1 NZ_CP117184:c1241771-1241553 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270044 WP_000344807.1 NZ_CP117184:c1242173-1241799 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|