Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1291884..1292801 | Replicon | chromosome |
Accession | NZ_CP117182 | ||
Organism | Bacillus velezensis strain Lwp6 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | PO767_RS06810 | Protein ID | WP_007407256.1 |
Coordinates | 1292055..1292801 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | PO767_RS06805 | Protein ID | WP_003154807.1 |
Coordinates | 1291884..1292054 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO767_RS06765 (1287117) | 1287117..1288739 | + | 1623 | WP_022553476.1 | pyocin knob domain-containing protein | - |
PO767_RS06770 (1288752) | 1288752..1289123 | + | 372 | WP_022553475.1 | XkdW family protein | - |
PO767_RS06775 (1289128) | 1289128..1289325 | + | 198 | WP_007610833.1 | XkdX family protein | - |
PO767_RS06780 (1289382) | 1289382..1290143 | + | 762 | WP_022553474.1 | hypothetical protein | - |
PO767_RS06785 (1290195) | 1290195..1290458 | + | 264 | WP_022553473.1 | hemolysin XhlA family protein | - |
PO767_RS06790 (1290472) | 1290472..1290735 | + | 264 | WP_003154813.1 | phage holin | - |
PO767_RS06795 (1290749) | 1290749..1291627 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
PO767_RS06800 (1291662) | 1291662..1291787 | - | 126 | WP_003154809.1 | hypothetical protein | - |
PO767_RS06805 (1291884) | 1291884..1292054 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
PO767_RS06810 (1292055) | 1292055..1292801 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
PO767_RS06815 (1292906) | 1292906..1293904 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
PO767_RS06820 (1293917) | 1293917..1294534 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
PO767_RS06825 (1294820) | 1294820..1296136 | - | 1317 | WP_007610842.1 | amino acid permease | - |
PO767_RS06830 (1296458) | 1296458..1297408 | + | 951 | WP_022553472.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1258174..1339373 | 81199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T270038 WP_007407256.1 NZ_CP117182:c1292801-1292055 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|