Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 485976..486613 | Replicon | chromosome |
| Accession | NZ_CP117182 | ||
| Organism | Bacillus velezensis strain Lwp6 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | PO767_RS02465 | Protein ID | WP_003156187.1 |
| Coordinates | 486263..486613 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | PO767_RS02460 | Protein ID | WP_003156188.1 |
| Coordinates | 485976..486257 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO767_RS02440 (482341) | 482341..482940 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
| PO767_RS02445 (483033) | 483033..483398 | + | 366 | WP_022552632.1 | holo-ACP synthase | - |
| PO767_RS02450 (483563) | 483563..484570 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
| PO767_RS02455 (484687) | 484687..485856 | + | 1170 | WP_022552633.1 | alanine racemase | - |
| PO767_RS02460 (485976) | 485976..486257 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| PO767_RS02465 (486263) | 486263..486613 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| PO767_RS02470 (486731) | 486731..487552 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| PO767_RS02475 (487557) | 487557..487922 | + | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
| PO767_RS02480 (487925) | 487925..488326 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| PO767_RS02485 (488338) | 488338..489345 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
| PO767_RS02490 (489409) | 489409..489738 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| PO767_RS02495 (489735) | 489735..490217 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
| PO767_RS02500 (490183) | 490183..490971 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
| PO767_RS02505 (490971) | 490971..491573 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T270037 WP_003156187.1 NZ_CP117182:486263-486613 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|