Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 4108080..4108602 | Replicon | chromosome |
| Accession | NZ_CP117181 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28S | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | V7IL40 |
| Locus tag | PQP75_RS19860 | Protein ID | WP_000221345.1 |
| Coordinates | 4108318..4108602 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | PQP75_RS19855 | Protein ID | WP_000885424.1 |
| Coordinates | 4108080..4108328 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP75_RS19825 (4103623) | 4103623..4104403 | + | 781 | Protein_3855 | helix-turn-helix domain-containing protein | - |
| PQP75_RS19830 (4104405) | 4104405..4105313 | - | 909 | WP_077906523.1 | hypothetical protein | - |
| PQP75_RS19835 (4105586) | 4105586..4105918 | - | 333 | WP_017441352.1 | DUF1493 family protein | - |
| PQP75_RS19840 (4106441) | 4106441..4106557 | - | 117 | Protein_3858 | IS110 family transposase | - |
| PQP75_RS19845 (4106922) | 4106922..4107311 | + | 390 | WP_017441353.1 | hypothetical protein | - |
| PQP75_RS19850 (4107314) | 4107314..4107667 | + | 354 | WP_000418733.1 | hypothetical protein | - |
| PQP75_RS19855 (4108080) | 4108080..4108328 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQP75_RS19860 (4108318) | 4108318..4108602 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP75_RS19865 (4108773) | 4108773..4109162 | + | 390 | WP_001652798.1 | RidA family protein | - |
| PQP75_RS19870 (4109220) | 4109220..4110293 | - | 1074 | WP_017441355.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| PQP75_RS19875 (4110486) | 4110486..4110974 | - | 489 | WP_017441356.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| PQP75_RS19880 (4111019) | 4111019..4112527 | + | 1509 | WP_017441357.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4098874..4115384 | 16510 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T270036 WP_000221345.1 NZ_CP117181:4108318-4108602 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |