Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2750016..2750830 | Replicon | chromosome |
Accession | NZ_CP117181 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28S |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A3W0Q3Z8 |
Locus tag | PQP75_RS13245 | Protein ID | WP_017441137.1 |
Coordinates | 2750016..2750543 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | A0A418Z520 |
Locus tag | PQP75_RS13250 | Protein ID | WP_017441138.1 |
Coordinates | 2750540..2750830 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP75_RS13215 (2746389) | 2746389..2746787 | + | 399 | Protein_2563 | cytoplasmic protein | - |
PQP75_RS13220 (2746978) | 2746978..2747217 | + | 240 | Protein_2564 | hypothetical protein | - |
PQP75_RS13225 (2747374) | 2747374..2748042 | + | 669 | WP_000445914.1 | hypothetical protein | - |
PQP75_RS13230 (2748069) | 2748069..2748563 | + | 495 | WP_000424947.1 | hypothetical protein | - |
PQP75_RS13235 (2748734) | 2748734..2749390 | - | 657 | WP_017441135.1 | protein-serine/threonine phosphatase | - |
PQP75_RS13240 (2749728) | 2749728..2749943 | + | 216 | Protein_2568 | IS5/IS1182 family transposase | - |
PQP75_RS13245 (2750016) | 2750016..2750543 | - | 528 | WP_017441137.1 | GNAT family N-acetyltransferase | Toxin |
PQP75_RS13250 (2750540) | 2750540..2750830 | - | 291 | WP_017441138.1 | DUF1778 domain-containing protein | Antitoxin |
PQP75_RS13255 (2751100) | 2751100..2751300 | - | 201 | Protein_2571 | IS3 family transposase | - |
PQP75_RS13260 (2751541) | 2751541..2751867 | + | 327 | WP_000393295.1 | hypothetical protein | - |
PQP75_RS13265 (2752140) | 2752140..2752487 | - | 348 | WP_001555786.1 | DUF1493 family protein | - |
PQP75_RS13270 (2752472) | 2752472..2752921 | - | 450 | WP_017441139.1 | hypothetical protein | - |
PQP75_RS13275 (2753353) | 2753353..2753796 | - | 444 | WP_017441140.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
PQP75_RS13280 (2754252) | 2754252..2754902 | + | 651 | WP_001728903.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 2749803..2760215 | 10412 | |
- | flank | IS/Tn | - | - | 2749803..2749943 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19035.89 Da Isoelectric Point: 9.6420
>T270030 WP_017441137.1 NZ_CP117181:c2750543-2750016 [Salmonella enterica subsp. enterica serovar Mbandaka]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SLKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SLKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10721.55 Da Isoelectric Point: 8.5957
>AT270030 WP_017441138.1 NZ_CP117181:c2750830-2750540 [Salmonella enterica subsp. enterica serovar Mbandaka]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFARPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFARPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3W0Q3Z8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A418Z520 |