Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1241362..1242143 | Replicon | chromosome |
Accession | NZ_CP117181 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28S |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A3G3E5T9 |
Locus tag | PQP75_RS06045 | Protein ID | WP_000625911.1 |
Coordinates | 1241362..1241853 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | V7IUD2 |
Locus tag | PQP75_RS06050 | Protein ID | WP_001271379.1 |
Coordinates | 1241850..1242143 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP75_RS06020 (1236496) | 1236496..1238934 | - | 2439 | WP_017441226.1 | F4 (K88) fimbrial usher FaeD | - |
PQP75_RS06025 (1238944) | 1238944..1239483 | - | 540 | WP_000721295.1 | type 1 fimbrial protein | - |
PQP75_RS06030 (1239518) | 1239518..1239808 | - | 291 | WP_000773469.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
PQP75_RS06035 (1240396) | 1240396..1240653 | + | 258 | WP_001112996.1 | hypothetical protein | - |
PQP75_RS06040 (1240899) | 1240899..1241147 | - | 249 | Protein_1176 | IS481 family transposase | - |
PQP75_RS06045 (1241362) | 1241362..1241853 | - | 492 | WP_000625911.1 | GNAT family N-acetyltransferase | Toxin |
PQP75_RS06050 (1241850) | 1241850..1242143 | - | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
PQP75_RS06055 (1242461) | 1242461..1242682 | + | 222 | WP_001595143.1 | hypothetical protein | - |
PQP75_RS06060 (1242948) | 1242948..1243823 | + | 876 | WP_017441228.1 | AraC family transcriptional regulator | - |
PQP75_RS06065 (1243820) | 1243820..1244107 | + | 288 | WP_072103482.1 | transcriptional regulator RtsB | - |
PQP75_RS06070 (1244114) | 1244114..1244281 | - | 168 | WP_071527476.1 | ATP-binding cassette domain-containing protein | - |
PQP75_RS06075 (1244301) | 1244301..1244400 | + | 100 | Protein_1183 | hypothetical protein | - |
PQP75_RS06080 (1244448) | 1244448..1244642 | + | 195 | WP_223195369.1 | hypothetical protein | - |
PQP75_RS06085 (1244936) | 1244936..1245841 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeI / faeH / faeF / faeE / faeD / faeC | 1229752..1244107 | 14355 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17663.44 Da Isoelectric Point: 7.2655
>T270023 WP_000625911.1 NZ_CP117181:c1241853-1241362 [Salmonella enterica subsp. enterica serovar Mbandaka]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10938.54 Da Isoelectric Point: 9.8590
>AT270023 WP_001271379.1 NZ_CP117181:c1242143-1241850 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G3E5T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V7IUD2 |