Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 1055099..1055649 Replicon chromosome
Accession NZ_CP117181
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28S

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag PQP75_RS05095 Protein ID WP_001199743.1
Coordinates 1055099..1055407 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V7ITQ8
Locus tag PQP75_RS05100 Protein ID WP_000016244.1
Coordinates 1055410..1055649 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP75_RS05075 (1050434) 1050434..1051345 + 912 WP_017441175.1 zincin-like metallopeptidase domain-containing protein -
PQP75_RS05080 (1051451) 1051451..1051906 + 456 WP_031615695.1 NUDIX domain-containing protein -
PQP75_RS05085 (1052197) 1052197..1053816 + 1620 WP_017441177.1 MobH family relaxase -
PQP75_RS05090 (1053806) 1053806..1054732 + 927 WP_017441178.1 site-specific integrase -
PQP75_RS05095 (1055099) 1055099..1055407 - 309 WP_001199743.1 CcdB family protein Toxin
PQP75_RS05100 (1055410) 1055410..1055649 - 240 WP_000016244.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PQP75_RS05105 (1055758) 1055758..1055982 - 225 WP_031233173.1 ribbon-helix-helix protein, CopG family -
PQP75_RS05110 (1056083) 1056083..1056391 - 309 Protein_995 DUF4942 domain-containing protein -
PQP75_RS05115 (1056411) 1056411..1057388 - 978 WP_223195356.1 IS630 family transposase -
PQP75_RS05125 (1058146) 1058146..1059165 + 1020 WP_000152563.1 NAD(P)-dependent alcohol dehydrogenase -
PQP75_RS05130 (1059193) 1059193..1059723 - 531 WP_017441181.1 gluconokinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1040909..1057343 16434
- flank IS/Tn - - 1056411..1057343 932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T270021 WP_001199743.1 NZ_CP117181:c1055407-1055099 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8709.86 Da        Isoelectric Point: 6.4633

>AT270021 WP_000016244.1 NZ_CP117181:c1055649-1055410 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5I5T4R8

References