Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 1055099..1055649 | Replicon | chromosome |
| Accession | NZ_CP117181 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28S | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | PQP75_RS05095 | Protein ID | WP_001199743.1 |
| Coordinates | 1055099..1055407 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | V7ITQ8 |
| Locus tag | PQP75_RS05100 | Protein ID | WP_000016244.1 |
| Coordinates | 1055410..1055649 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP75_RS05075 (1050434) | 1050434..1051345 | + | 912 | WP_017441175.1 | zincin-like metallopeptidase domain-containing protein | - |
| PQP75_RS05080 (1051451) | 1051451..1051906 | + | 456 | WP_031615695.1 | NUDIX domain-containing protein | - |
| PQP75_RS05085 (1052197) | 1052197..1053816 | + | 1620 | WP_017441177.1 | MobH family relaxase | - |
| PQP75_RS05090 (1053806) | 1053806..1054732 | + | 927 | WP_017441178.1 | site-specific integrase | - |
| PQP75_RS05095 (1055099) | 1055099..1055407 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| PQP75_RS05100 (1055410) | 1055410..1055649 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| PQP75_RS05105 (1055758) | 1055758..1055982 | - | 225 | WP_031233173.1 | ribbon-helix-helix protein, CopG family | - |
| PQP75_RS05110 (1056083) | 1056083..1056391 | - | 309 | Protein_995 | DUF4942 domain-containing protein | - |
| PQP75_RS05115 (1056411) | 1056411..1057388 | - | 978 | WP_223195356.1 | IS630 family transposase | - |
| PQP75_RS05125 (1058146) | 1058146..1059165 | + | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| PQP75_RS05130 (1059193) | 1059193..1059723 | - | 531 | WP_017441181.1 | gluconokinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1040909..1057343 | 16434 | |
| - | flank | IS/Tn | - | - | 1056411..1057343 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T270021 WP_001199743.1 NZ_CP117181:c1055407-1055099 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I5T4R8 |