Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 310576..311196 | Replicon | chromosome |
Accession | NZ_CP117181 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28S |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP75_RS01515 | Protein ID | WP_001280991.1 |
Coordinates | 310978..311196 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQP75_RS01510 | Protein ID | WP_000344807.1 |
Coordinates | 310576..310950 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP75_RS01500 (305715) | 305715..306908 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQP75_RS01505 (306931) | 306931..310080 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQP75_RS01510 (310576) | 310576..310950 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQP75_RS01515 (310978) | 310978..311196 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP75_RS01520 (311375) | 311375..311926 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
PQP75_RS01525 (312042) | 312042..312512 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PQP75_RS01530 (312568) | 312568..312708 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP75_RS01535 (312714) | 312714..312974 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP75_RS01540 (313199) | 313199..314749 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
PQP75_RS01550 (314980) | 314980..315369 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQP75_RS01555 (315402) | 315402..315971 | - | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270013 WP_001280991.1 NZ_CP117181:310978-311196 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270013 WP_000344807.1 NZ_CP117181:310576-310950 [Salmonella enterica subsp. enterica serovar Mbandaka]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|