Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 6201..6754 Replicon plasmid unnamed2
Accession NZ_CP117170
Organism Serratia proteamaculans strain CD3406

Toxin (Protein)


Gene name ccdB Uniprot ID A0A0T9N0J0
Locus tag JET59_RS27320 Protein ID WP_050074641.1
Coordinates 6440..6754 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A7L6C0I8
Locus tag JET59_RS27315 Protein ID WP_050074640.1
Coordinates 6201..6437 (+) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JET59_RS27285 (JET59_027285) 1247..1909 + 663 WP_050074635.1 division plane positioning ATPase MipZ -
JET59_RS27290 (JET59_027290) 2004..2285 + 282 WP_050074636.1 hypothetical protein -
JET59_RS27295 (JET59_027295) 2376..3446 - 1071 WP_072090086.1 hypothetical protein -
JET59_RS27300 (JET59_027300) 3493..3846 - 354 WP_050074637.1 DNA distortion polypeptide 3 -
JET59_RS27305 (JET59_027305) 4023..4457 - 435 WP_050074638.1 hypothetical protein -
JET59_RS27310 (JET59_027310) 4466..5350 - 885 WP_050074639.1 replication initiation protein -
JET59_RS27315 (JET59_027315) 6201..6437 + 237 WP_050074640.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
JET59_RS27320 (JET59_027320) 6440..6754 + 315 WP_050074641.1 CcdB family protein Toxin
JET59_RS27325 (JET59_027325) 7312..7827 + 516 WP_050074642.1 J domain-containing protein -
JET59_RS27330 (JET59_027330) 7869..8411 + 543 WP_050074643.1 hypothetical protein -
JET59_RS27335 (JET59_027335) 8421..8687 + 267 WP_230676841.1 hypothetical protein -
JET59_RS27340 (JET59_027340) 8680..8898 + 219 WP_050074645.1 hypothetical protein -
JET59_RS27345 (JET59_027345) 8994..9338 + 345 WP_080991619.1 hypothetical protein -
JET59_RS27350 (JET59_027350) 9580..9837 + 258 WP_050074646.1 hypothetical protein -
JET59_RS27355 (JET59_027355) 10175..10720 + 546 WP_050074647.1 DNA distortion polypeptide 1 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..51609 51609


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(9-78)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11733.73 Da        Isoelectric Point: 6.9730

>T270011 WP_050074641.1 NZ_CP117170:6440-6754 [Serratia proteamaculans]
MQFTVYQNTGKTTIYPYLLDVTSDIIGQLNRRIVIPLLPLEKYPTGKRPERMIPIVMLTDGNEYAVMTHELASIPVRALG
AEFCTAVQYRSQVKASIDFLLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8923.99 Da        Isoelectric Point: 5.8061

>AT270011 WP_050074640.1 NZ_CP117170:6201-6437 [Serratia proteamaculans]
MATKQRNTQSVTMTLERGLLNQAREAGINLSATLVAALDAELRRYAAQKWQKENMEALDALNRFHDENGCFSDEYRTF

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0T9N0J0

Antitoxin

Source ID Structure
AlphaFold DB A0A7L6C0I8

References