Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 6201..6754 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP117170 | ||
| Organism | Serratia proteamaculans strain CD3406 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A0T9N0J0 |
| Locus tag | JET59_RS27320 | Protein ID | WP_050074641.1 |
| Coordinates | 6440..6754 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A7L6C0I8 |
| Locus tag | JET59_RS27315 | Protein ID | WP_050074640.1 |
| Coordinates | 6201..6437 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JET59_RS27285 (JET59_027285) | 1247..1909 | + | 663 | WP_050074635.1 | division plane positioning ATPase MipZ | - |
| JET59_RS27290 (JET59_027290) | 2004..2285 | + | 282 | WP_050074636.1 | hypothetical protein | - |
| JET59_RS27295 (JET59_027295) | 2376..3446 | - | 1071 | WP_072090086.1 | hypothetical protein | - |
| JET59_RS27300 (JET59_027300) | 3493..3846 | - | 354 | WP_050074637.1 | DNA distortion polypeptide 3 | - |
| JET59_RS27305 (JET59_027305) | 4023..4457 | - | 435 | WP_050074638.1 | hypothetical protein | - |
| JET59_RS27310 (JET59_027310) | 4466..5350 | - | 885 | WP_050074639.1 | replication initiation protein | - |
| JET59_RS27315 (JET59_027315) | 6201..6437 | + | 237 | WP_050074640.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| JET59_RS27320 (JET59_027320) | 6440..6754 | + | 315 | WP_050074641.1 | CcdB family protein | Toxin |
| JET59_RS27325 (JET59_027325) | 7312..7827 | + | 516 | WP_050074642.1 | J domain-containing protein | - |
| JET59_RS27330 (JET59_027330) | 7869..8411 | + | 543 | WP_050074643.1 | hypothetical protein | - |
| JET59_RS27335 (JET59_027335) | 8421..8687 | + | 267 | WP_230676841.1 | hypothetical protein | - |
| JET59_RS27340 (JET59_027340) | 8680..8898 | + | 219 | WP_050074645.1 | hypothetical protein | - |
| JET59_RS27345 (JET59_027345) | 8994..9338 | + | 345 | WP_080991619.1 | hypothetical protein | - |
| JET59_RS27350 (JET59_027350) | 9580..9837 | + | 258 | WP_050074646.1 | hypothetical protein | - |
| JET59_RS27355 (JET59_027355) | 10175..10720 | + | 546 | WP_050074647.1 | DNA distortion polypeptide 1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..51609 | 51609 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11733.73 Da Isoelectric Point: 6.9730
>T270011 WP_050074641.1 NZ_CP117170:6440-6754 [Serratia proteamaculans]
MQFTVYQNTGKTTIYPYLLDVTSDIIGQLNRRIVIPLLPLEKYPTGKRPERMIPIVMLTDGNEYAVMTHELASIPVRALG
AEFCTAVQYRSQVKASIDFLLDGI
MQFTVYQNTGKTTIYPYLLDVTSDIIGQLNRRIVIPLLPLEKYPTGKRPERMIPIVMLTDGNEYAVMTHELASIPVRALG
AEFCTAVQYRSQVKASIDFLLDGI
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0T9N0J0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6C0I8 |