Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelE(toxin) |
Location | 5247698..5248263 | Replicon | chromosome |
Accession | NZ_CP117168 | ||
Organism | Serratia proteamaculans strain CD3406 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | JET59_RS24680 | Protein ID | WP_219017132.1 |
Coordinates | 5247985..5248263 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | JET59_RS24675 | Protein ID | WP_219017131.1 |
Coordinates | 5247698..5247967 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JET59_RS24660 (JET59_024660) | 5243918..5245135 | - | 1218 | WP_099063534.1 | aspartate aminotransferase family protein | - |
JET59_RS24665 (JET59_024665) | 5245267..5245842 | - | 576 | WP_219017130.1 | aminodeoxychorismate synthase component II | - |
JET59_RS24670 (JET59_024670) | 5245941..5247467 | - | 1527 | WP_099063532.1 | DUF853 family protein | - |
JET59_RS24675 (JET59_024675) | 5247698..5247967 | + | 270 | WP_219017131.1 | hypothetical protein | Antitoxin |
JET59_RS24680 (JET59_024680) | 5247985..5248263 | + | 279 | WP_219017132.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JET59_RS24685 (JET59_024685) | 5248264..5248989 | - | 726 | WP_099063529.1 | two-component system response regulator BtsR | - |
JET59_RS24690 (JET59_024690) | 5248989..5250674 | - | 1686 | WP_099063528.1 | sensor histidine kinase | - |
JET59_RS24695 (JET59_024695) | 5250836..5251405 | - | 570 | WP_099063527.1 | peptidylprolyl isomerase A | - |
JET59_RS24700 (JET59_024700) | 5251762..5252100 | + | 339 | WP_219017212.1 | PTS lactose/cellobiose transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10127.78 Da Isoelectric Point: 9.8649
>T270010 WP_219017132.1 NZ_CP117168:5247985-5248263 [Serratia proteamaculans]
VKLKWTEPAIADRMAIYDYLASKNPVAAAEIDALISAATARLSQNPLSGKPGRAPGTRELVIHHSYLLIYELTNGPLIIL
AVVHARRQWPKD
VKLKWTEPAIADRMAIYDYLASKNPVAAAEIDALISAATARLSQNPLSGKPGRAPGTRELVIHHSYLLIYELTNGPLIIL
AVVHARRQWPKD
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|