Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4584687..4585356 | Replicon | chromosome |
| Accession | NZ_CP117168 | ||
| Organism | Serratia proteamaculans strain CD3406 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | JET59_RS21480 | Protein ID | WP_099063843.1 |
| Coordinates | 4584687..4585109 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A2X2G343 |
| Locus tag | JET59_RS21485 | Protein ID | WP_037418284.1 |
| Coordinates | 4585090..4585356 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JET59_RS21460 (JET59_021460) | 4580571..4581089 | + | 519 | WP_085118696.1 | flavodoxin FldB | - |
| JET59_RS21465 (JET59_021465) | 4581130..4582494 | - | 1365 | WP_219016885.1 | cell envelope integrity protein CreD | - |
| JET59_RS21470 (JET59_021470) | 4582577..4583995 | - | 1419 | WP_219016886.1 | two-component system sensor histidine kinase CreC | - |
| JET59_RS21475 (JET59_021475) | 4583992..4584687 | - | 696 | WP_085118700.1 | two-component system response regulator CreB | - |
| JET59_RS21480 (JET59_021480) | 4584687..4585109 | - | 423 | WP_099063843.1 | protein YgfX | Toxin |
| JET59_RS21485 (JET59_021485) | 4585090..4585356 | - | 267 | WP_037418284.1 | FAD assembly factor SdhE | Antitoxin |
| JET59_RS21490 (JET59_021490) | 4585680..4586672 | + | 993 | WP_099063844.1 | tRNA-modifying protein YgfZ | - |
| JET59_RS21495 (JET59_021495) | 4586758..4587432 | - | 675 | WP_085118705.1 | hemolysin III family protein | - |
| JET59_RS21500 (JET59_021500) | 4587616..4588224 | + | 609 | WP_099063845.1 | HD domain-containing protein | - |
| JET59_RS21505 (JET59_021505) | 4588275..4589600 | - | 1326 | WP_219016887.1 | MFS transporter | - |
| JET59_RS21510 (JET59_021510) | 4589597..4590250 | - | 654 | WP_219016888.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16439.32 Da Isoelectric Point: 10.5155
>T270009 WP_099063843.1 NZ_CP117168:c4585109-4584687 [Serratia proteamaculans]
VAQWRCDVRISWRTQLLSLLTHGALILLILISPWPEGYGPIWLVLLTLVVFECIRSQKRIASRQGELRLLENQRLGWHGQ
EWQLVKQPWMPRYGILLTLQPVGGKKRRRLWLASDAMAKADWRHLRQQLLYPPASDDEEP
VAQWRCDVRISWRTQLLSLLTHGALILLILISPWPEGYGPIWLVLLTLVVFECIRSQKRIASRQGELRLLENQRLGWHGQ
EWQLVKQPWMPRYGILLTLQPVGGKKRRRLWLASDAMAKADWRHLRQQLLYPPASDDEEP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|