Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4193720..4194372 | Replicon | chromosome |
Accession | NZ_CP117168 | ||
Organism | Serratia proteamaculans strain CD3406 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | JET59_RS19670 | Protein ID | WP_099062615.1 |
Coordinates | 4193720..4194106 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | JET59_RS19675 | Protein ID | WP_112348659.1 |
Coordinates | 4194109..4194372 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JET59_RS19655 (JET59_019655) | 4190188..4191618 | + | 1431 | WP_099062612.1 | MFS transporter | - |
JET59_RS19660 (JET59_019660) | 4191615..4192997 | + | 1383 | WP_219016767.1 | two-component system sensor histidine kinase BaeS | - |
JET59_RS19665 (JET59_019665) | 4192997..4193713 | + | 717 | WP_219016796.1 | two-component system response regulator BaeR | - |
JET59_RS19670 (JET59_019670) | 4193720..4194106 | - | 387 | WP_099062615.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JET59_RS19675 (JET59_019675) | 4194109..4194372 | - | 264 | WP_112348659.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
JET59_RS19680 (JET59_019680) | 4194727..4195065 | + | 339 | WP_099062617.1 | YegP family protein | - |
JET59_RS19685 (JET59_019685) | 4195244..4196596 | + | 1353 | WP_219016768.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
JET59_RS19690 (JET59_019690) | 4197086..4198003 | + | 918 | WP_099062619.1 | lipid kinase YegS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14192.53 Da Isoelectric Point: 9.5368
>T270008 WP_099062615.1 NZ_CP117168:c4194106-4193720 [Serratia proteamaculans]
MYMFDTNTVSQLFRRHPRLLRVMEKIPPSAVCISSITEAELLYGVAKRQSLALKATVAAFLDSVTVYAWDREAAHCYGTM
RADMAKKGRVMGALDQLIAAHAQSRGATIVTNDKAFAMVPGLRVEDWT
MYMFDTNTVSQLFRRHPRLLRVMEKIPPSAVCISSITEAELLYGVAKRQSLALKATVAAFLDSVTVYAWDREAAHCYGTM
RADMAKKGRVMGALDQLIAAHAQSRGATIVTNDKAFAMVPGLRVEDWT
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|