Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 4159904..4160371 | Replicon | chromosome |
| Accession | NZ_CP117168 | ||
| Organism | Serratia proteamaculans strain CD3406 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | JET59_RS19555 | Protein ID | WP_219016758.1 |
| Coordinates | 4159904..4160173 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | JET59_RS19560 | Protein ID | WP_099062595.1 |
| Coordinates | 4160177..4160371 (-) | Length | 65 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JET59_RS19525 (JET59_019525) | 4155098..4155613 | + | 516 | WP_129936911.1 | E3 ubiquitin--protein ligase | - |
| JET59_RS19530 (JET59_019530) | 4155644..4155892 | + | 249 | WP_006316897.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| JET59_RS19535 (JET59_019535) | 4155945..4157234 | - | 1290 | WP_112348682.1 | uracil permease | - |
| JET59_RS19540 (JET59_019540) | 4157296..4157922 | - | 627 | WP_017893631.1 | uracil phosphoribosyltransferase | - |
| JET59_RS19545 (JET59_019545) | 4158178..4159215 | + | 1038 | WP_085118131.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| JET59_RS19550 (JET59_019550) | 4159215..4159853 | + | 639 | WP_219016757.1 | phosphoribosylglycinamide formyltransferase | - |
| JET59_RS19555 (JET59_019555) | 4159904..4160173 | - | 270 | WP_219016758.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JET59_RS19560 (JET59_019560) | 4160177..4160371 | - | 195 | WP_099062595.1 | hypothetical protein | Antitoxin |
| JET59_RS19565 (JET59_019565) | 4160518..4161072 | + | 555 | WP_099062596.1 | spermidine N1-acetyltransferase | - |
| JET59_RS19570 (JET59_019570) | 4161151..4161963 | - | 813 | WP_085118133.1 | phosphate ABC transporter ATP-binding protein PstB | - |
| JET59_RS19575 (JET59_019575) | 4161992..4163644 | - | 1653 | WP_207979918.1 | phosphate ABC transporter permease PstA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10548.18 Da Isoelectric Point: 6.4826
>T270007 WP_219016758.1 NZ_CP117168:c4160173-4159904 [Serratia proteamaculans]
MRIEWSSEAQEELWSIIDYIDDRNPQAARKLHREIEAVVLTLPLNPLMYRLGRVDNTREIVVHPNYLVVYRVIGHIEVLS
VIHAKREYP
MRIEWSSEAQEELWSIIDYIDDRNPQAARKLHREIEAVVLTLPLNPLMYRLGRVDNTREIVVHPNYLVVYRVIGHIEVLS
VIHAKREYP
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|