Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3486141..3486772 | Replicon | chromosome |
| Accession | NZ_CP117168 | ||
| Organism | Serratia proteamaculans strain CD3406 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | JET59_RS16415 | Protein ID | WP_099064654.1 |
| Coordinates | 3486141..3486539 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | JET59_RS16420 | Protein ID | WP_085117342.1 |
| Coordinates | 3486539..3486772 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JET59_RS16390 (JET59_016390) | 3481712..3482098 | + | 387 | WP_219016530.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| JET59_RS16395 (JET59_016395) | 3482079..3482381 | + | 303 | WP_006321467.1 | helix-turn-helix domain-containing protein | - |
| JET59_RS16400 (JET59_016400) | 3482385..3482789 | - | 405 | WP_099064651.1 | flagellar protein FlhE | - |
| JET59_RS16405 (JET59_016405) | 3482789..3484867 | - | 2079 | WP_112349619.1 | flagellar biosynthesis protein FlhA | - |
| JET59_RS16410 (JET59_016410) | 3484860..3486011 | - | 1152 | WP_099064653.1 | flagellar biosynthesis protein FlhB | - |
| JET59_RS16415 (JET59_016415) | 3486141..3486539 | - | 399 | WP_099064654.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JET59_RS16420 (JET59_016420) | 3486539..3486772 | - | 234 | WP_085117342.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| JET59_RS16425 (JET59_016425) | 3486897..3487541 | - | 645 | WP_099064655.1 | protein phosphatase CheZ | - |
| JET59_RS16430 (JET59_016430) | 3487552..3487941 | - | 390 | WP_037418944.1 | chemotaxis response regulator CheY | - |
| JET59_RS16435 (JET59_016435) | 3488155..3489204 | - | 1050 | WP_099064657.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
| JET59_RS16440 (JET59_016440) | 3489204..3490076 | - | 873 | WP_026142427.1 | protein-glutamate O-methyltransferase CheR | - |
| JET59_RS16445 (JET59_016445) | 3490105..3491730 | - | 1626 | WP_219016534.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15068.36 Da Isoelectric Point: 8.1127
>T270006 WP_099064654.1 NZ_CP117168:c3486539-3486141 [Serratia proteamaculans]
MFSHMLDTNIVIYVIKRRPLEVLQRFNQHAGKMVISSVTYAELIHGVEKSMRPTENARVIDDFVSRLEILDYTAKAAAHY
GNIRACLERQGTPIGINDLHIAGHARSEGLVLVTNNLREFERVDGLRLQNWL
MFSHMLDTNIVIYVIKRRPLEVLQRFNQHAGKMVISSVTYAELIHGVEKSMRPTENARVIDDFVSRLEILDYTAKAAAHY
GNIRACLERQGTPIGINDLHIAGHARSEGLVLVTNNLREFERVDGLRLQNWL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|