Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 2125855..2126492 | Replicon | chromosome |
Accession | NZ_CP117168 | ||
Organism | Serratia proteamaculans strain CD3406 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | JET59_RS10045 | Protein ID | WP_219015875.1 |
Coordinates | 2126217..2126492 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | JET59_RS10040 | Protein ID | WP_219015874.1 |
Coordinates | 2125855..2126220 (-) | Length | 122 a.a. |
Genomic Context
Location: 2122190..2123911 (1722 bp)
Type: Others
Protein ID: WP_219015872.1
Type: Others
Protein ID: WP_219015872.1
Location: 2123913..2124968 (1056 bp)
Type: Others
Protein ID: WP_219015873.1
Type: Others
Protein ID: WP_219015873.1
Location: 2121198..2122031 (834 bp)
Type: Others
Protein ID: WP_219015871.1
Type: Others
Protein ID: WP_219015871.1
Location: 2125855..2126220 (366 bp)
Type: Antitoxin
Protein ID: WP_219015874.1
Type: Antitoxin
Protein ID: WP_219015874.1
Location: 2126217..2126492 (276 bp)
Type: Toxin
Protein ID: WP_219015875.1
Type: Toxin
Protein ID: WP_219015875.1
Location: 2126567..2126938 (372 bp)
Type: Others
Protein ID: WP_219015876.1
Type: Others
Protein ID: WP_219015876.1
Location: 2126953..2127645 (693 bp)
Type: Others
Protein ID: WP_219015877.1
Type: Others
Protein ID: WP_219015877.1
Location: 2127824..2130283 (2460 bp)
Type: Others
Protein ID: WP_219015878.1
Type: Others
Protein ID: WP_219015878.1
Location: 2130280..2130822 (543 bp)
Type: Others
Protein ID: WP_219015879.1
Type: Others
Protein ID: WP_219015879.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JET59_RS10025 (JET59_010025) | 2121198..2122031 | - | 834 | WP_219015871.1 | GPO family capsid scaffolding protein | - |
JET59_RS10030 (JET59_010030) | 2122190..2123911 | + | 1722 | WP_219015872.1 | terminase family protein | - |
JET59_RS10035 (JET59_010035) | 2123913..2124968 | + | 1056 | WP_219015873.1 | phage portal protein | - |
JET59_RS10040 (JET59_010040) | 2125855..2126220 | - | 366 | WP_219015874.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
JET59_RS10045 (JET59_010045) | 2126217..2126492 | - | 276 | WP_219015875.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
JET59_RS10050 (JET59_010050) | 2126567..2126938 | - | 372 | WP_219015876.1 | ClpX C4-type zinc finger protein | - |
JET59_RS10055 (JET59_010055) | 2126953..2127645 | - | 693 | WP_219015877.1 | DNA adenine methylase | - |
JET59_RS10060 (JET59_010060) | 2127824..2130283 | - | 2460 | WP_219015878.1 | replication endonuclease | - |
JET59_RS10065 (JET59_010065) | 2130280..2130822 | - | 543 | WP_219015879.1 | ead/Ea22-like family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2102648..2138025 | 35377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10126.72 Da Isoelectric Point: 10.6115
>T270001 WP_219015875.1 NZ_CP117168:c2126492-2126217 [Serratia proteamaculans]
MKEQVSALRKRQKSTLEQIFKTPVLSGIKWSDVESLIKALGGEVKEGRGSRCKFLLNGSIANFHRPHPSPDTDKGAVVNL
REWLESIGVKP
MKEQVSALRKRQKSTLEQIFKTPVLSGIKWSDVESLIKALGGEVKEGRGSRCKFLLNGSIANFHRPHPSPDTDKGAVVNL
REWLESIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13315.04 Da Isoelectric Point: 4.7301
>AT270001 WP_219015874.1 NZ_CP117168:c2126220-2125855 [Serratia proteamaculans]
MTKTVAAAPNTMEIAGQPAIISYVPEIGAFRGKFLGLTGYCDFVSDSIQGLHAEGEISLREYLDDCSAAGIEPYARQEKI
KTFTLRYPESFGERLNQAAAEHEVSVNAFIVETLNERMKHA
MTKTVAAAPNTMEIAGQPAIISYVPEIGAFRGKFLGLTGYCDFVSDSIQGLHAEGEISLREYLDDCSAAGIEPYARQEKI
KTFTLRYPESFGERLNQAAAEHEVSVNAFIVETLNERMKHA
Download Length: 366 bp