Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1916080..1916605 Replicon chromosome
Accession NZ_CP117168
Organism Serratia proteamaculans strain CD3406

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag JET59_RS09060 Protein ID WP_219015794.1
Coordinates 1916080..1916364 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag JET59_RS09065 Protein ID WP_085116028.1
Coordinates 1916354..1916605 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JET59_RS09035 (JET59_009035) 1911213..1912346 + 1134 WP_099065101.1 putrescine ABC transporter ATP-binding subunit PotG -
JET59_RS09040 (JET59_009040) 1912378..1913337 + 960 WP_129935207.1 putrescine ABC transporter permease PotH -
JET59_RS09045 (JET59_009045) 1913334..1914179 + 846 WP_099065100.1 putrescine ABC transporter permease PotI -
JET59_RS09050 (JET59_009050) 1914408..1914887 + 480 WP_099065099.1 YbjO family protein -
JET59_RS09055 (JET59_009055) 1914956..1916083 + 1128 WP_099065098.1 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC -
JET59_RS09060 (JET59_009060) 1916080..1916364 - 285 WP_219015794.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
JET59_RS09065 (JET59_009065) 1916354..1916605 - 252 WP_085116028.1 prevent-host-death protein Antitoxin
JET59_RS09070 (JET59_009070) 1916737..1916904 + 168 WP_170925006.1 hypothetical protein -
JET59_RS09075 (JET59_009075) 1916901..1917518 - 618 WP_219015795.1 Fic family protein -
JET59_RS09080 (JET59_009080) 1917607..1918341 - 735 WP_219015796.1 arginine ABC transporter substrate-binding protein -
JET59_RS09085 (JET59_009085) 1918550..1919218 - 669 WP_085116031.1 arginine ABC transporter permease ArtM -
JET59_RS09090 (JET59_009090) 1919218..1919934 - 717 WP_099065096.1 arginine ABC transporter permease ArtQ -
JET59_RS09095 (JET59_009095) 1919944..1920675 - 732 WP_207980104.1 arginine ABC transporter substrate-binding protein -
JET59_RS09100 (JET59_009100) 1920709..1921437 - 729 WP_099065094.1 arginine ABC transporter ATP-binding protein ArtP -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1901088..1916904 15816


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10861.87 Da        Isoelectric Point: 10.3031

>T270000 WP_219015794.1 NZ_CP117168:c1916364-1916080 [Serratia proteamaculans]
MTYNLEFEEHALKEFKKLAPVIREQFKRKLVAVVENPLVPANKLSGLHDCYKIKLKASGYRLVYRVIGEEIVVLVLSIGK
RERSEAYTSAKKRL

Download         Length: 285 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9018.37 Da        Isoelectric Point: 4.6895

>AT270000 WP_085116028.1 NZ_CP117168:c1916605-1916354 [Serratia proteamaculans]
MIVQPILADSAVSISDFKKSPNAALKEANGQPVAVLTNGKISGYYVSPETWQAIAECLEDIELAEIVRSRMSGKRIKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References