Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 1330379..1331144 | Replicon | chromosome |
| Accession | NZ_CP117168 | ||
| Organism | Serratia proteamaculans strain CD3406 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A443W6R0 |
| Locus tag | JET59_RS06230 | Protein ID | WP_032729493.1 |
| Coordinates | 1330776..1331144 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A330G4J1 |
| Locus tag | JET59_RS06225 | Protein ID | WP_032729492.1 |
| Coordinates | 1330379..1330735 (+) | Length | 119 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JET59_RS06185 (JET59_006185) | 1325541..1326425 | + | 885 | WP_032729486.1 | 50S ribosome-binding GTPase | - |
| JET59_RS06190 (JET59_006190) | 1326875..1327603 | + | 729 | WP_032729489.1 | WYL domain-containing protein | - |
| JET59_RS06195 (JET59_006195) | 1327600..1328103 | + | 504 | WP_226881293.1 | hypothetical protein | - |
| JET59_RS06200 (JET59_006200) | 1328138..1328425 | + | 288 | WP_226881291.1 | hypothetical protein | - |
| JET59_RS06205 (JET59_006205) | 1328438..1328749 | + | 312 | WP_032729490.1 | hypothetical protein | - |
| JET59_RS06210 (JET59_006210) | 1328832..1329188 | + | 357 | WP_032729491.1 | hypothetical protein | - |
| JET59_RS06215 (JET59_006215) | 1329385..1329843 | + | 459 | WP_050597274.1 | antirestriction protein | - |
| JET59_RS06220 (JET59_006220) | 1329871..1330350 | + | 480 | WP_032730964.1 | DNA repair protein RadC | - |
| JET59_RS06225 (JET59_006225) | 1330379..1330735 | + | 357 | WP_032729492.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JET59_RS06230 (JET59_006230) | 1330776..1331144 | + | 369 | WP_032729493.1 | TA system toxin CbtA family protein | Toxin |
| JET59_RS06235 (JET59_006235) | 1331141..1331470 | + | 330 | WP_050597275.1 | DUF5983 family protein | - |
| JET59_RS06240 (JET59_006240) | 1331570..1331674 | + | 105 | Protein_1204 | restriction endonuclease subunit M | - |
| JET59_RS06245 (JET59_006245) | 1332130..1333020 | - | 891 | WP_219015570.1 | alpha/beta hydrolase | - |
| JET59_RS06250 (JET59_006250) | 1333084..1333584 | - | 501 | WP_219015571.1 | nuclear transport factor 2 family protein | - |
| JET59_RS06255 (JET59_006255) | 1333851..1334519 | - | 669 | WP_099065383.1 | isochorismatase family protein | - |
| JET59_RS06260 (JET59_006260) | 1334675..1335025 | + | 351 | WP_207976184.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13412.45 Da Isoelectric Point: 9.1775
>T269998 WP_032729493.1 NZ_CP117168:1330776-1331144 [Serratia proteamaculans]
MRTVPAPPSRAAQTCPSPITVWQSLLTYLLAQHYGLTLNDTAFSDDAVIQAHIDNGMSLADVLNAMVEKFELVRIDRRGF
TGQAQSPLVTVIDILRARRACGLMTRAGYREVTRAIQGSKQP
MRTVPAPPSRAAQTCPSPITVWQSLLTYLLAQHYGLTLNDTAFSDDAVIQAHIDNGMSLADVLNAMVEKFELVRIDRRGF
TGQAQSPLVTVIDILRARRACGLMTRAGYREVTRAIQGSKQP
Download Length: 369 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 13508.27 Da Isoelectric Point: 6.9037
>AT269998 WP_032729492.1 NZ_CP117168:1330379-1330735 [Serratia proteamaculans]
MPSPHNVPAWGLKRNVTPQFGARLVQERERLHFLADRADISGIFSDAQRHDLENAFPQFIKHLELMLLSGELNPRHQHCV
TLYCHGLTCEADSLGSYGYVYISIYPTSETPRYNAPHF
MPSPHNVPAWGLKRNVTPQFGARLVQERERLHFLADRADISGIFSDAQRHDLENAFPQFIKHLELMLLSGELNPRHQHCV
TLYCHGLTCEADSLGSYGYVYISIYPTSETPRYNAPHF
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A443W6R0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A330G4J1 |