Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 1330379..1331144 Replicon chromosome
Accession NZ_CP117168
Organism Serratia proteamaculans strain CD3406

Toxin (Protein)


Gene name ypjF Uniprot ID A0A443W6R0
Locus tag JET59_RS06230 Protein ID WP_032729493.1
Coordinates 1330776..1331144 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A330G4J1
Locus tag JET59_RS06225 Protein ID WP_032729492.1
Coordinates 1330379..1330735 (+) Length 119 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JET59_RS06185 (JET59_006185) 1325541..1326425 + 885 WP_032729486.1 50S ribosome-binding GTPase -
JET59_RS06190 (JET59_006190) 1326875..1327603 + 729 WP_032729489.1 WYL domain-containing protein -
JET59_RS06195 (JET59_006195) 1327600..1328103 + 504 WP_226881293.1 hypothetical protein -
JET59_RS06200 (JET59_006200) 1328138..1328425 + 288 WP_226881291.1 hypothetical protein -
JET59_RS06205 (JET59_006205) 1328438..1328749 + 312 WP_032729490.1 hypothetical protein -
JET59_RS06210 (JET59_006210) 1328832..1329188 + 357 WP_032729491.1 hypothetical protein -
JET59_RS06215 (JET59_006215) 1329385..1329843 + 459 WP_050597274.1 antirestriction protein -
JET59_RS06220 (JET59_006220) 1329871..1330350 + 480 WP_032730964.1 DNA repair protein RadC -
JET59_RS06225 (JET59_006225) 1330379..1330735 + 357 WP_032729492.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
JET59_RS06230 (JET59_006230) 1330776..1331144 + 369 WP_032729493.1 TA system toxin CbtA family protein Toxin
JET59_RS06235 (JET59_006235) 1331141..1331470 + 330 WP_050597275.1 DUF5983 family protein -
JET59_RS06240 (JET59_006240) 1331570..1331674 + 105 Protein_1204 restriction endonuclease subunit M -
JET59_RS06245 (JET59_006245) 1332130..1333020 - 891 WP_219015570.1 alpha/beta hydrolase -
JET59_RS06250 (JET59_006250) 1333084..1333584 - 501 WP_219015571.1 nuclear transport factor 2 family protein -
JET59_RS06255 (JET59_006255) 1333851..1334519 - 669 WP_099065383.1 isochorismatase family protein -
JET59_RS06260 (JET59_006260) 1334675..1335025 + 351 WP_207976184.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-111)

Antitoxin

Antitoxin CbeA

(8-107)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13412.45 Da        Isoelectric Point: 9.1775

>T269998 WP_032729493.1 NZ_CP117168:1330776-1331144 [Serratia proteamaculans]
MRTVPAPPSRAAQTCPSPITVWQSLLTYLLAQHYGLTLNDTAFSDDAVIQAHIDNGMSLADVLNAMVEKFELVRIDRRGF
TGQAQSPLVTVIDILRARRACGLMTRAGYREVTRAIQGSKQP

Download         Length: 369 bp

Antitoxin


Download         Length: 119 a.a.        Molecular weight: 13508.27 Da        Isoelectric Point: 6.9037

>AT269998 WP_032729492.1 NZ_CP117168:1330379-1330735 [Serratia proteamaculans]
MPSPHNVPAWGLKRNVTPQFGARLVQERERLHFLADRADISGIFSDAQRHDLENAFPQFIKHLELMLLSGELNPRHQHCV
TLYCHGLTCEADSLGSYGYVYISIYPTSETPRYNAPHF

Download         Length: 357 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A443W6R0

Antitoxin

Source ID Structure
AlphaFold DB A0A330G4J1

References