Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1230760..1231387 Replicon chromosome
Accession NZ_CP117168
Organism Serratia proteamaculans strain CD3406

Toxin (Protein)


Gene name Hha Uniprot ID A0A2X2GU35
Locus tag JET59_RS05760 Protein ID WP_012005558.1
Coordinates 1230760..1230963 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag JET59_RS05765 Protein ID WP_004940312.1
Coordinates 1231019..1231387 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JET59_RS05745 (JET59_005745) 1226318..1227661 - 1344 WP_219015551.1 NCS2 family permease -
JET59_RS05750 (JET59_005750) 1227826..1229613 - 1788 WP_219015552.1 adenine deaminase C-terminal domain-containing protein -
JET59_RS05755 (JET59_005755) 1229751..1230680 + 930 WP_219015553.1 LysR family transcriptional regulator -
JET59_RS05760 (JET59_005760) 1230760..1230963 - 204 WP_012005558.1 HHA domain-containing protein Toxin
JET59_RS05765 (JET59_005765) 1231019..1231387 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
JET59_RS05770 (JET59_005770) 1231550..1231903 - 354 WP_232519151.1 hypothetical protein -
JET59_RS05775 (JET59_005775) 1232352..1233065 + 714 WP_219015554.1 ABC transporter ATP-binding protein -
JET59_RS05780 (JET59_005780) 1233062..1233919 + 858 WP_219015555.1 metal ABC transporter permease -
JET59_RS05785 (JET59_005785) 1233945..1234823 + 879 WP_219015556.1 metal ABC transporter substrate-binding protein -
JET59_RS05790 (JET59_005790) 1234941..1235081 - 141 WP_085115485.1 type B 50S ribosomal protein L36 -
JET59_RS05795 (JET59_005795) 1235094..1235351 - 258 WP_099065369.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8101.45 Da        Isoelectric Point: 6.9770

>T269997 WP_012005558.1 NZ_CP117168:c1230963-1230760 [Serratia proteamaculans]
MTKIDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTAVWKFVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT269997 WP_004940312.1 NZ_CP117168:c1231387-1231019 [Serratia proteamaculans]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2X2GU35

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References