Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/Tad-HTH_37 |
| Location | 999414..1000104 | Replicon | chromosome |
| Accession | NZ_CP117168 | ||
| Organism | Serratia proteamaculans strain CD3406 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | - |
| Locus tag | JET59_RS04680 | Protein ID | WP_099064956.1 |
| Coordinates | 999730..1000104 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | - |
| Locus tag | JET59_RS04675 | Protein ID | WP_207976426.1 |
| Coordinates | 999414..999743 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JET59_RS04655 (JET59_004655) | 995312..996772 | - | 1461 | WP_207976435.1 | NCS1 family nucleobase:cation symporter-1 | - |
| JET59_RS04660 (JET59_004660) | 996939..997688 | + | 750 | WP_219015452.1 | GntR family transcriptional regulator | - |
| JET59_RS04665 (JET59_004665) | 997685..998428 | + | 744 | WP_219015453.1 | aspartate/glutamate racemase family protein | - |
| JET59_RS04670 (JET59_004670) | 998448..999386 | + | 939 | WP_219015454.1 | allantoinase PuuE | - |
| JET59_RS04675 (JET59_004675) | 999414..999743 | - | 330 | WP_207976426.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| JET59_RS04680 (JET59_004680) | 999730..1000104 | - | 375 | WP_099064956.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JET59_RS04685 (JET59_004685) | 1000205..1002442 | - | 2238 | WP_099064955.1 | TonB-dependent siderophore receptor | - |
| JET59_RS04690 (JET59_004690) | 1002479..1003807 | - | 1329 | WP_219015455.1 | lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13828.04 Da Isoelectric Point: 9.7052
>T269996 WP_099064956.1 NZ_CP117168:c1000104-999730 [Serratia proteamaculans]
MDTHRVRQLVWIASSKKDLLSLPDEVIKSVGYSLHCAQAGLIPPGVKALKGFQGAGVLEVVEDHDSNTYRAVYTLRFEDA
VFVLHCFQKKSKTGVATPKADIELIKSRLNRAKQVYEDMKNGKI
MDTHRVRQLVWIASSKKDLLSLPDEVIKSVGYSLHCAQAGLIPPGVKALKGFQGAGVLEVVEDHDSNTYRAVYTLRFEDA
VFVLHCFQKKSKTGVATPKADIELIKSRLNRAKQVYEDMKNGKI
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|