Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 5727703..5728289 | Replicon | chromosome |
| Accession | NZ_CP117167 | ||
| Organism | Mucilaginibacter jinjuensis strain KACC 16571 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PQO05_RS24760 | Protein ID | WP_273630152.1 |
| Coordinates | 5727703..5728086 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PQO05_RS24765 | Protein ID | WP_273630153.1 |
| Coordinates | 5728086..5728289 (-) | Length | 68 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQO05_RS24735 (PQO05_24735) | 5722857..5724548 | - | 1692 | WP_273630147.1 | glycosyltransferase family 39 protein | - |
| PQO05_RS24740 (PQO05_24740) | 5724690..5724926 | + | 237 | WP_273630148.1 | hypothetical protein | - |
| PQO05_RS24745 (PQO05_24745) | 5725058..5725474 | + | 417 | WP_273630149.1 | hypothetical protein | - |
| PQO05_RS24750 (PQO05_24750) | 5725629..5726900 | - | 1272 | WP_273630150.1 | serine--tRNA ligase | - |
| PQO05_RS24755 (PQO05_24755) | 5727028..5727702 | + | 675 | WP_273630151.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| PQO05_RS24760 (PQO05_24760) | 5727703..5728086 | - | 384 | WP_273630152.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PQO05_RS24765 (PQO05_24765) | 5728086..5728289 | - | 204 | WP_273630153.1 | DUF2281 domain-containing protein | Antitoxin |
| PQO05_RS24770 (PQO05_24770) | 5728349..5729950 | + | 1602 | WP_273630154.1 | apolipoprotein N-acyltransferase | - |
| PQO05_RS24775 (PQO05_24775) | 5730020..5730871 | - | 852 | WP_273630155.1 | N-acetylglucosamine kinase | - |
| PQO05_RS24780 (PQO05_24780) | 5730868..5731251 | - | 384 | WP_174314849.1 | response regulator | - |
| PQO05_RS24785 (PQO05_24785) | 5731302..5732621 | - | 1320 | WP_273630156.1 | TolC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14813.20 Da Isoelectric Point: 4.9320
>T269993 WP_273630152.1 NZ_CP117167:c5728086-5727703 [Mucilaginibacter jinjuensis]
MDYLLDTHILLWFINGEELDQDLINKIKDPDNKIFLSIASLWEIAIKHSLGKLPLQSEFSELKEILRNTNIEILPIEFSH
LQALLALPDIHNDPFDRIIIAQAIHEKLKLITRDSKFKNYPADITWV
MDYLLDTHILLWFINGEELDQDLINKIKDPDNKIFLSIASLWEIAIKHSLGKLPLQSEFSELKEILRNTNIEILPIEFSH
LQALLALPDIHNDPFDRIIIAQAIHEKLKLITRDSKFKNYPADITWV
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|