Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-MqsA |
| Location | 3712926..3713625 | Replicon | chromosome |
| Accession | NZ_CP117166 | ||
| Organism | Proteus mirabilis strain 181-3b | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | B4EZ96 |
| Locus tag | PRR80_RS17175 | Protein ID | WP_004249093.1 |
| Coordinates | 3712926..3713312 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | B4EZ97 |
| Locus tag | PRR80_RS17180 | Protein ID | WP_004246828.1 |
| Coordinates | 3713305..3713625 (+) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PRR80_RS17160 (PRR80_17160) | 3708939..3709520 | - | 582 | WP_012368524.1 | DNA-3-methyladenine glycosylase I | - |
| PRR80_RS17165 (PRR80_17165) | 3709771..3710676 | + | 906 | WP_004246832.1 | glycine--tRNA ligase subunit alpha | - |
| PRR80_RS17170 (PRR80_17170) | 3710686..3712758 | + | 2073 | WP_017827114.1 | glycine--tRNA ligase subunit beta | - |
| PRR80_RS17175 (PRR80_17175) | 3712926..3713312 | + | 387 | WP_004249093.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PRR80_RS17180 (PRR80_17180) | 3713305..3713625 | + | 321 | WP_004246828.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PRR80_RS17185 (PRR80_17185) | 3713676..3714110 | - | 435 | WP_004246827.1 | hypothetical protein | - |
| PRR80_RS17190 (PRR80_17190) | 3714103..3714987 | - | 885 | WP_004249091.1 | endonuclease/exonuclease/phosphatase family protein | - |
| PRR80_RS17195 (PRR80_17195) | 3715205..3716491 | - | 1287 | WP_074561560.1 | DUF3748 domain-containing protein | - |
| PRR80_RS17200 (PRR80_17200) | 3716628..3717245 | + | 618 | WP_004246822.1 | trimeric intracellular cation channel family protein | - |
| PRR80_RS17205 (PRR80_17205) | 3717547..3718170 | + | 624 | WP_004246821.1 | guanylate kinase | - |
| PRR80_RS17210 (PRR80_17210) | 3718225..3718500 | + | 276 | WP_004246820.1 | DNA-directed RNA polymerase subunit omega | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14294.64 Da Isoelectric Point: 10.0642
>T269991 WP_004249093.1 NZ_CP117166:3712926-3713312 [Proteus mirabilis]
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVKYD
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVKYD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|