Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1692043..1692842 | Replicon | chromosome |
Accession | NZ_CP117166 | ||
Organism | Proteus mirabilis strain 181-3b |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A8E3RD10 |
Locus tag | PRR80_RS07925 | Protein ID | WP_004247966.1 |
Coordinates | 1692318..1692842 (+) | Length | 175 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | B4EVS2 |
Locus tag | PRR80_RS07920 | Protein ID | WP_004247964.1 |
Coordinates | 1692043..1692321 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PRR80_RS07895 (PRR80_07895) | 1687393..1688475 | + | 1083 | WP_004242680.1 | peptide chain release factor 1 | - |
PRR80_RS07900 (PRR80_07900) | 1688475..1689323 | + | 849 | WP_164527482.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
PRR80_RS07905 (PRR80_07905) | 1689301..1690116 | + | 816 | WP_088207195.1 | invasion regulator SirB1 | - |
PRR80_RS07910 (PRR80_07910) | 1690174..1691028 | + | 855 | WP_004242689.1 | 3-deoxy-8-phosphooctulonate synthase | - |
PRR80_RS07915 (PRR80_07915) | 1691036..1691965 | + | 930 | WP_004242691.1 | TIGR01212 family radical SAM protein | - |
PRR80_RS07920 (PRR80_07920) | 1692043..1692321 | + | 279 | WP_004247964.1 | DUF1778 domain-containing protein | Antitoxin |
PRR80_RS07925 (PRR80_07925) | 1692318..1692842 | + | 525 | WP_004247966.1 | hypothetical protein | Toxin |
PRR80_RS07930 (PRR80_07930) | 1692923..1694623 | - | 1701 | WP_004242694.1 | C4-dicarboxylic acid transporter DauA | - |
PRR80_RS07940 (PRR80_07940) | 1695586..1696527 | + | 942 | WP_004242695.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19192.12 Da Isoelectric Point: 9.3561
>T269988 WP_004247966.1 NZ_CP117166:1692318-1692842 [Proteus mirabilis]
MTIPNWHEEAISKKHNRNGFNCGDAVLNQFLYRHARQNHENGSAKTYLAINNSNNIILGYYSLCPASIEFERTPELIKHG
LARHDIPVFKLARLATDLSVQGKGLGGQLLLAAGRRCLSVASELGGVALLIDAKNERVANWYISYGAIPLLDTPLSLLIS
FKTIYTALSMANKI
MTIPNWHEEAISKKHNRNGFNCGDAVLNQFLYRHARQNHENGSAKTYLAINNSNNIILGYYSLCPASIEFERTPELIKHG
LARHDIPVFKLARLATDLSVQGKGLGGQLLLAAGRRCLSVASELGGVALLIDAKNERVANWYISYGAIPLLDTPLSLLIS
FKTIYTALSMANKI
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|