Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 12432..13033 Replicon chromosome
Accession NZ_CP117166
Organism Proteus mirabilis strain 181-3b

Toxin (Protein)


Gene name doc Uniprot ID A0A1Z1SQZ4
Locus tag PRR80_RS00055 Protein ID WP_036895893.1
Coordinates 12432..12815 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A1Z1SPN9
Locus tag PRR80_RS00060 Protein ID WP_004246496.1
Coordinates 12812..13033 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PRR80_RS00030 (PRR80_00030) 7730..8299 + 570 WP_004249768.1 rRNA adenine N-6-methyltransferase family protein -
PRR80_RS00035 (PRR80_00035) 8355..9842 - 1488 WP_164527249.1 PLP-dependent aminotransferase family protein -
PRR80_RS00040 (PRR80_00040) 9971..10429 + 459 WP_164527250.1 GNAT family N-acetyltransferase -
PRR80_RS00045 (PRR80_00045) 10525..11262 - 738 WP_164527251.1 tetratricopeptide repeat protein -
PRR80_RS00050 (PRR80_00050) 11371..12270 + 900 WP_017628715.1 N-acetylmuramic acid 6-phosphate etherase -
PRR80_RS00055 (PRR80_00055) 12432..12815 - 384 WP_036895893.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PRR80_RS00060 (PRR80_00060) 12812..13033 - 222 WP_004246496.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PRR80_RS00065 (PRR80_00065) 13255..14118 - 864 WP_164527252.1 YicC/YloC family endoribonuclease -
PRR80_RS00070 (PRR80_00070) 14245..14961 + 717 WP_004249760.1 ribonuclease PH -
PRR80_RS00075 (PRR80_00075) 15043..15687 + 645 WP_164527253.1 orotate phosphoribosyltransferase -
PRR80_RS00080 (PRR80_00080) 16006..16611 - 606 WP_004246491.1 nucleoid occlusion factor SlmA -
PRR80_RS00085 (PRR80_00085) 16731..17189 - 459 WP_004246490.1 dUTP diphosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-125)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-52)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14518.52 Da        Isoelectric Point: 8.4945

>T269987 WP_036895893.1 NZ_CP117166:c12815-12432 [Proteus mirabilis]
MIWVSAQEVIAFHDRILQRFPGVAGMSDPGRAEALIYRVQNRKHYEGITDVFELAATYWVAIARGRIFNDGNKRTAFFVT
MTFLYRNGIRIRDTDNTLENLTVEAATGEKTVDQLAKHLQNLVEKTN

Download         Length: 384 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8260.23 Da        Isoelectric Point: 5.5667

>AT269987 WP_004246496.1 NZ_CP117166:c13033-12812 [Proteus mirabilis]
MRTYTSTQARANISEVLDIATHGEPVEITRRDGCSAVVISKTEFESYQNAKLDAEFDMMMQRHGHTVEALTNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Z1SQZ4

Antitoxin

Source ID Structure
AlphaFold DB A0A1Z1SPN9

References