Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-parD/RelE-RHH |
Location | 247877..248448 | Replicon | chromosome |
Accession | NZ_CP117159 | ||
Organism | Sphingobium sp. AntQ-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A8G1ZF93 |
Locus tag | sphantq_RS19990 | Protein ID | WP_066609131.1 |
Coordinates | 248161..248448 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A8G1ZG49 |
Locus tag | sphantq_RS19985 | Protein ID | WP_066609130.1 |
Coordinates | 247877..248164 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
sphantq_RS19970 (sphantq_03961) | 243802..245265 | - | 1464 | WP_272800503.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
sphantq_RS19975 (sphantq_03962) | 245262..246134 | - | 873 | WP_272800504.1 | GNAT family N-acetyltransferase | - |
sphantq_RS19980 (sphantq_03963) | 246339..247811 | + | 1473 | WP_272800505.1 | aldehyde dehydrogenase family protein | - |
sphantq_RS19985 (sphantq_03964) | 247877..248164 | + | 288 | WP_066609130.1 | hypothetical protein | Antitoxin |
sphantq_RS19990 (sphantq_03965) | 248161..248448 | + | 288 | WP_066609131.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
sphantq_RS19995 (sphantq_03966) | 248458..249591 | - | 1134 | WP_272800506.1 | FAD-binding oxidoreductase | - |
sphantq_RS20000 (sphantq_03967) | 249588..250961 | - | 1374 | WP_272800507.1 | NAD(P)/FAD-dependent oxidoreductase | - |
sphantq_RS20005 (sphantq_03968) | 250943..251248 | - | 306 | WP_129927148.1 | (2Fe-2S)-binding protein | - |
sphantq_RS20010 (sphantq_03969) | 251245..252168 | - | 924 | WP_272800508.1 | ATP-binding cassette domain-containing protein | - |
sphantq_RS20015 | 252572..253063 | - | 492 | Protein_231 | ATP-binding cassette domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11124.81 Da Isoelectric Point: 11.3576
>T269984 WP_066609131.1 NZ_CP117159:248161-248448 [Sphingobium sp. AntQ-1]
MRLRWTADAVRDRDAIYDYVEARSPRAAIRLDTLFSQRAADLSRLPAMGRPGRVPGTRELIAHRNYILVYDLTDTDVRIL
RLLHAARLWPPQERR
MRLRWTADAVRDRDAIYDYVEARSPRAAIRLDTLFSQRAADLSRLPAMGRPGRVPGTRELIAHRNYILVYDLTDTDVRIL
RLLHAARLWPPQERR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|