Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 793095..793642 | Replicon | chromosome |
| Accession | NZ_CP117054 | ||
| Organism | Vibrio harveyi strain VH21FL | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PQE20_RS03725 | Protein ID | WP_272759633.1 |
| Coordinates | 793095..793397 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | U3A269 |
| Locus tag | PQE20_RS03730 | Protein ID | WP_005448240.1 |
| Coordinates | 793385..793642 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQE20_RS03670 (PQE20_03670) | 788274..789212 | - | 939 | WP_272759859.1 | hypothetical protein | - |
| PQE20_RS03675 (PQE20_03675) | 789176..789268 | - | 93 | WP_101945361.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03680 (PQE20_03680) | 789283..790281 | - | 999 | WP_258479436.1 | hypothetical protein | - |
| PQE20_RS03685 (PQE20_03685) | 790374..790484 | - | 111 | WP_072609782.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03690 (PQE20_03690) | 790503..790964 | - | 462 | WP_050903769.1 | GNAT family N-acetyltransferase | - |
| PQE20_RS03695 (PQE20_03695) | 791131..791706 | - | 576 | WP_272759631.1 | hypothetical protein | - |
| PQE20_RS03700 (PQE20_03700) | 791734..791823 | - | 90 | WP_079884698.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03705 (PQE20_03705) | 791841..792281 | - | 441 | WP_272759632.1 | hypothetical protein | - |
| PQE20_RS03710 (PQE20_03710) | 792319..792411 | - | 93 | WP_078532186.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03715 (PQE20_03715) | 792426..792938 | - | 513 | WP_053306502.1 | hypothetical protein | - |
| PQE20_RS03720 (PQE20_03720) | 792967..793059 | - | 93 | WP_004748931.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03725 (PQE20_03725) | 793095..793397 | - | 303 | WP_272759633.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQE20_RS03730 (PQE20_03730) | 793385..793642 | - | 258 | WP_005448240.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQE20_RS03735 (PQE20_03735) | 793844..794197 | - | 354 | WP_025625246.1 | DUF6404 family protein | - |
| PQE20_RS03740 (PQE20_03740) | 794370..794843 | - | 474 | WP_195877583.1 | hypothetical protein | - |
| PQE20_RS03745 (PQE20_03745) | 794871..795002 | - | 132 | WP_167425888.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03750 (PQE20_03750) | 795406..795499 | - | 94 | Protein_747 | DUF3265 domain-containing protein | - |
| PQE20_RS03755 (PQE20_03755) | 795489..796124 | - | 636 | WP_272759634.1 | hypothetical protein | - |
| PQE20_RS03760 (PQE20_03760) | 796232..796684 | - | 453 | WP_147270108.1 | hypothetical protein | - |
| PQE20_RS03765 (PQE20_03765) | 796721..796813 | - | 93 | WP_272759635.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03770 (PQE20_03770) | 796853..797158 | - | 306 | WP_114732536.1 | hypothetical protein | - |
| PQE20_RS03775 (PQE20_03775) | 797327..798484 | - | 1158 | WP_069687262.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 739704..835952 | 96248 | |
| - | inside | Integron | - | - | 744386..835952 | 91566 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11653.57 Da Isoelectric Point: 5.8808
>T269979 WP_272759633.1 NZ_CP117054:c793397-793095 [Vibrio harveyi]
MAEVIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLRTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLGKQ
MAEVIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLRTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLGKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|