Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 780290..780837 | Replicon | chromosome |
| Accession | NZ_CP117054 | ||
| Organism | Vibrio harveyi strain VH21FL | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A347UR19 |
| Locus tag | PQE20_RS03580 | Protein ID | WP_025548916.1 |
| Coordinates | 780290..780592 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PQE20_RS03585 | Protein ID | WP_272759624.1 |
| Coordinates | 780580..780837 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQE20_RS03530 (PQE20_03530) | 775630..776307 | - | 678 | WP_136678231.1 | FRG domain-containing protein | - |
| PQE20_RS03535 (PQE20_03535) | 776353..776442 | - | 90 | WP_072039143.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03540 (PQE20_03540) | 776460..776738 | - | 279 | WP_086495580.1 | hypothetical protein | - |
| PQE20_RS03545 (PQE20_03545) | 776911..777678 | - | 768 | WP_272759621.1 | hypothetical protein | - |
| PQE20_RS03550 (PQE20_03550) | 777709..777801 | - | 93 | WP_202796573.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03555 (PQE20_03555) | 777816..778589 | - | 774 | WP_272759622.1 | NERD domain-containing protein | - |
| PQE20_RS03560 (PQE20_03560) | 778681..779289 | - | 609 | WP_203488146.1 | GIY-YIG nuclease family protein | - |
| PQE20_RS03565 (PQE20_03565) | 779427..779492 | - | 66 | Protein_710 | DUF3265 domain-containing protein | - |
| PQE20_RS03570 (PQE20_03570) | 779489..780115 | - | 627 | WP_272759623.1 | hypothetical protein | - |
| PQE20_RS03575 (PQE20_03575) | 780162..780251 | - | 90 | WP_072016691.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03580 (PQE20_03580) | 780290..780592 | - | 303 | WP_025548916.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQE20_RS03585 (PQE20_03585) | 780580..780837 | - | 258 | WP_272759624.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQE20_RS03590 (PQE20_03590) | 781035..781448 | - | 414 | WP_272759625.1 | hypothetical protein | - |
| PQE20_RS03595 (PQE20_03595) | 782182..782271 | - | 90 | WP_081097987.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03600 (PQE20_03600) | 782301..782600 | - | 300 | WP_023585853.1 | hypothetical protein | - |
| PQE20_RS03605 (PQE20_03605) | 782779..783069 | - | 291 | WP_272759626.1 | hypothetical protein | - |
| PQE20_RS03610 (PQE20_03610) | 783101..783229 | - | 129 | WP_099098883.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03615 (PQE20_03615) | 783648..783740 | - | 93 | WP_140050440.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03620 (PQE20_03620) | 783760..784182 | - | 423 | WP_272759627.1 | hypothetical protein | - |
| PQE20_RS03625 (PQE20_03625) | 784209..784298 | - | 90 | WP_072615218.1 | DUF3265 domain-containing protein | - |
| PQE20_RS03630 (PQE20_03630) | 784316..784669 | - | 354 | WP_015296924.1 | glyoxalase/bleomycin resistance/dioxygenase family protein | - |
| PQE20_RS03635 (PQE20_03635) | 784776..785576 | - | 801 | WP_039839644.1 | Cthe_2314 family HEPN domain-containing protein | - |
| PQE20_RS03640 (PQE20_03640) | 785610..785687 | - | 78 | WP_272759836.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 739704..835952 | 96248 | |
| - | inside | Integron | - | - | 744386..835952 | 91566 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11669.57 Da Isoelectric Point: 5.1765
>T269978 WP_025548916.1 NZ_CP117054:c780592-780290 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|