Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 780290..780837 Replicon chromosome
Accession NZ_CP117054
Organism Vibrio harveyi strain VH21FL

Toxin (Protein)


Gene name relE Uniprot ID A0A347UR19
Locus tag PQE20_RS03580 Protein ID WP_025548916.1
Coordinates 780290..780592 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PQE20_RS03585 Protein ID WP_272759624.1
Coordinates 780580..780837 (-) Length 86 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQE20_RS03530 (PQE20_03530) 775630..776307 - 678 WP_136678231.1 FRG domain-containing protein -
PQE20_RS03535 (PQE20_03535) 776353..776442 - 90 WP_072039143.1 DUF3265 domain-containing protein -
PQE20_RS03540 (PQE20_03540) 776460..776738 - 279 WP_086495580.1 hypothetical protein -
PQE20_RS03545 (PQE20_03545) 776911..777678 - 768 WP_272759621.1 hypothetical protein -
PQE20_RS03550 (PQE20_03550) 777709..777801 - 93 WP_202796573.1 DUF3265 domain-containing protein -
PQE20_RS03555 (PQE20_03555) 777816..778589 - 774 WP_272759622.1 NERD domain-containing protein -
PQE20_RS03560 (PQE20_03560) 778681..779289 - 609 WP_203488146.1 GIY-YIG nuclease family protein -
PQE20_RS03565 (PQE20_03565) 779427..779492 - 66 Protein_710 DUF3265 domain-containing protein -
PQE20_RS03570 (PQE20_03570) 779489..780115 - 627 WP_272759623.1 hypothetical protein -
PQE20_RS03575 (PQE20_03575) 780162..780251 - 90 WP_072016691.1 DUF3265 domain-containing protein -
PQE20_RS03580 (PQE20_03580) 780290..780592 - 303 WP_025548916.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQE20_RS03585 (PQE20_03585) 780580..780837 - 258 WP_272759624.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQE20_RS03590 (PQE20_03590) 781035..781448 - 414 WP_272759625.1 hypothetical protein -
PQE20_RS03595 (PQE20_03595) 782182..782271 - 90 WP_081097987.1 DUF3265 domain-containing protein -
PQE20_RS03600 (PQE20_03600) 782301..782600 - 300 WP_023585853.1 hypothetical protein -
PQE20_RS03605 (PQE20_03605) 782779..783069 - 291 WP_272759626.1 hypothetical protein -
PQE20_RS03610 (PQE20_03610) 783101..783229 - 129 WP_099098883.1 DUF3265 domain-containing protein -
PQE20_RS03615 (PQE20_03615) 783648..783740 - 93 WP_140050440.1 DUF3265 domain-containing protein -
PQE20_RS03620 (PQE20_03620) 783760..784182 - 423 WP_272759627.1 hypothetical protein -
PQE20_RS03625 (PQE20_03625) 784209..784298 - 90 WP_072615218.1 DUF3265 domain-containing protein -
PQE20_RS03630 (PQE20_03630) 784316..784669 - 354 WP_015296924.1 glyoxalase/bleomycin resistance/dioxygenase family protein -
PQE20_RS03635 (PQE20_03635) 784776..785576 - 801 WP_039839644.1 Cthe_2314 family HEPN domain-containing protein -
PQE20_RS03640 (PQE20_03640) 785610..785687 - 78 WP_272759836.1 DUF3265 domain-containing protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 739704..835952 96248
- inside Integron - - 744386..835952 91566


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 101 a.a.        Molecular weight: 11669.57 Da        Isoelectric Point: 5.1765

>T269978 WP_025548916.1 NZ_CP117054:c780592-780290 [Vibrio harveyi]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ

Download         Length: 303 bp


Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9663.19 Da        Isoelectric Point: 7.3176

>AT269978 WP_272759624.1 NZ_CP117054:c780837-780580 [Vibrio harveyi]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADDKVVSHDKAKDKM
SKWLK

Download         Length: 258 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A347UR19


Antitoxin

Source ID Structure

References