Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafN(antitoxin)
Location 771179..771744 Replicon chromosome
Accession NZ_CP117054
Organism Vibrio harveyi strain VH21FL

Toxin (Protein)


Gene name relE Uniprot ID A0A916ASF8
Locus tag PQE20_RS03470 Protein ID WP_005445239.1
Coordinates 771179..771466 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U3BLE1
Locus tag PQE20_RS03475 Protein ID WP_000086647.1
Coordinates 771463..771744 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQE20_RS03410 (PQE20_03410) 766225..766314 - 90 WP_079749348.1 DUF3265 domain-containing protein -
PQE20_RS03415 (PQE20_03415) 766349..766753 - 405 WP_272759617.1 hydrolase -
PQE20_RS03420 (PQE20_03420) 766786..766878 - 93 WP_195724112.1 DUF3265 domain-containing protein -
PQE20_RS03425 (PQE20_03425) 766922..767506 - 585 WP_050903463.1 hypothetical protein -
PQE20_RS03430 (PQE20_03430) 767563..767673 - 111 WP_272759835.1 DUF3265 domain-containing protein -
PQE20_RS03435 (PQE20_03435) 767670..768302 - 633 WP_272759618.1 DUF4145 domain-containing protein -
PQE20_RS03440 (PQE20_03440) 768462..768788 - 327 WP_227740576.1 hypothetical protein -
PQE20_RS03445 (PQE20_03445) 768869..768946 - 78 Protein_686 DUF3265 domain-containing protein -
PQE20_RS03450 (PQE20_03450) 769424..769471 - 48 WP_231572698.1 hypothetical protein -
PQE20_RS03455 (PQE20_03455) 769542..770468 - 927 WP_272759619.1 hypothetical protein -
PQE20_RS03460 (PQE20_03460) 770513..770656 - 144 WP_081634798.1 DUF3265 domain-containing protein -
PQE20_RS03465 (PQE20_03465) 771059..771148 - 90 WP_080254104.1 DUF3265 domain-containing protein -
PQE20_RS03470 (PQE20_03470) 771179..771466 - 288 WP_005445239.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQE20_RS03475 (PQE20_03475) 771463..771744 - 282 WP_000086647.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQE20_RS03480 (PQE20_03480) 771835..771927 - 93 WP_004402681.1 DUF3265 domain-containing protein -
PQE20_RS03485 (PQE20_03485) 771950..772450 - 501 WP_069492142.1 hypothetical protein -
PQE20_RS03490 (PQE20_03490) 772488..772580 - 93 WP_083135200.1 DUF3265 domain-containing protein -
PQE20_RS03495 (PQE20_03495) 772850..773380 - 531 WP_049538686.1 hypothetical protein -
PQE20_RS03500 (PQE20_03500) 773489..773618 - 130 Protein_697 DUF3265 domain-containing protein -
PQE20_RS03505 (PQE20_03505) 774037..774129 - 93 WP_072600976.1 DUF3265 domain-containing protein -
PQE20_RS03510 (PQE20_03510) 774163..774579 - 417 WP_272759620.1 hypothetical protein -
PQE20_RS03515 (PQE20_03515) 774592..774801 - 210 WP_039477363.1 hypothetical protein -
PQE20_RS03520 (PQE20_03520) 774921..775013 - 93 WP_078555105.1 DUF3265 domain-containing protein -
PQE20_RS03525 (PQE20_03525) 775028..775525 - 498 WP_104027818.1 GNAT family N-acetyltransferase -
PQE20_RS03530 (PQE20_03530) 775630..776307 - 678 WP_136678231.1 FRG domain-containing protein -
PQE20_RS03535 (PQE20_03535) 776353..776442 - 90 WP_072039143.1 DUF3265 domain-containing protein -
PQE20_RS03540 (PQE20_03540) 776460..776738 - 279 WP_086495580.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 739704..835952 96248
- inside Integron - - 744386..835952 91566


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-74)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11031.70 Da        Isoelectric Point: 5.1098

>T269977 WP_005445239.1 NZ_CP117054:c771466-771179 [Vibrio harveyi]
MKVVWSPLALQKLGDAAEFISLDNPPAAERWVNEVFDKTELLGSMPEMGRFVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQILSEDDV

Download         Length: 288 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10398.91 Da        Isoelectric Point: 5.8650

>AT269977 WP_000086647.1 NZ_CP117054:c771744-771463 [Vibrio harveyi]
MSRIHFDQDIQPLSEFRAGVASYIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLASGLGVSN
DDARAQVLGRIKK

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4P8G0X0

References