Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2541303..2541941 | Replicon | chromosome |
Accession | NZ_CP117053 | ||
Organism | Escherichia coli strain MLI106K4 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | NL407_RS13495 | Protein ID | WP_001447010.1 |
Coordinates | 2541765..2541941 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NL407_RS13490 | Protein ID | WP_001270286.1 |
Coordinates | 2541303..2541719 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL407_RS13470 (2536455) | 2536455..2537396 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
NL407_RS13475 (2537397) | 2537397..2538410 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
NL407_RS13480 (2538428) | 2538428..2539573 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
NL407_RS13485 (2539818) | 2539818..2541224 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
NL407_RS13490 (2541303) | 2541303..2541719 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NL407_RS13495 (2541765) | 2541765..2541941 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NL407_RS13500 (2542163) | 2542163..2542393 | + | 231 | WP_000494244.1 | YncJ family protein | - |
NL407_RS13505 (2542485) | 2542485..2544446 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NL407_RS13510 (2544519) | 2544519..2545055 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
NL407_RS13515 (2545147) | 2545147..2546322 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T269965 WP_001447010.1 NZ_CP117053:c2541941-2541765 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT269965 WP_001270286.1 NZ_CP117053:c2541719-2541303 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|