Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 990788..991371 | Replicon | chromosome |
Accession | NZ_CP117053 | ||
Organism | Escherichia coli strain MLI106K4 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | NL407_RS05955 | Protein ID | WP_000254738.1 |
Coordinates | 991036..991371 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | NL407_RS05950 | Protein ID | WP_000581937.1 |
Coordinates | 990788..991036 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL407_RS05940 (987127) | 987127..988428 | + | 1302 | WP_001521172.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
NL407_RS05945 (988476) | 988476..990710 | + | 2235 | WP_000226798.1 | GTP diphosphokinase | - |
NL407_RS05950 (990788) | 990788..991036 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NL407_RS05955 (991036) | 991036..991371 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
NL407_RS05960 (991443) | 991443..992234 | + | 792 | WP_001071643.1 | nucleoside triphosphate pyrophosphohydrolase | - |
NL407_RS05965 (992462) | 992462..994099 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
NL407_RS05970 (994186) | 994186..995484 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 996050..996427 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T269956 WP_000254738.1 NZ_CP117053:991036-991371 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|