Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 834237..834891 | Replicon | chromosome |
Accession | NZ_CP117053 | ||
Organism | Escherichia coli strain MLI106K4 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | NL407_RS05240 | Protein ID | WP_000244781.1 |
Coordinates | 834484..834891 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NL407_RS05235 | Protein ID | WP_000354046.1 |
Coordinates | 834237..834503 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL407_RS05215 (830325) | 830325..831758 | - | 1434 | WP_001521235.1 | 6-phospho-beta-glucosidase BglA | - |
NL407_RS05220 (831803) | 831803..832114 | + | 312 | WP_001182949.1 | N(4)-acetylcytidine aminohydrolase | - |
NL407_RS05225 (832278) | 832278..832937 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
NL407_RS05230 (833014) | 833014..833994 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
NL407_RS05235 (834237) | 834237..834503 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NL407_RS05240 (834484) | 834484..834891 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
NL407_RS05245 (834931) | 834931..835452 | - | 522 | WP_001521233.1 | flavodoxin FldB | - |
NL407_RS05250 (835564) | 835564..836460 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NL407_RS05255 (836485) | 836485..837195 | + | 711 | WP_001521231.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NL407_RS05260 (837201) | 837201..838934 | + | 1734 | WP_021523238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T269955 WP_000244781.1 NZ_CP117053:834484-834891 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|