Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 150922..151447 Replicon plasmid p174_MLI106-4
Accession NZ_CP117050
Organism Escherichia coli strain MLI106K4

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NL407_RS00940 Protein ID WP_001159871.1
Coordinates 150922..151227 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag NL407_RS00945 Protein ID WP_000813630.1
Coordinates 151229..151447 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL407_RS00925 (146884) 146884..148050 - 1167 WP_000772446.1 plasmid-partitioning protein SopA -
NL407_RS00930 (148638) 148638..149393 - 756 WP_000852146.1 replication initiation protein RepE -
NL407_RS00935 (150115) 150115..150921 - 807 WP_000016970.1 site-specific integrase -
NL407_RS00940 (150922) 150922..151227 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NL407_RS00945 (151229) 151229..151447 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NL407_RS00950 (152007) 152007..152237 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
NL407_RS00955 (152234) 152234..152650 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
NL407_RS00960 (152725) 152725..154290 + 1566 WP_001128474.1 AAA family ATPase -
NL407_RS00965 (154275) 154275..155297 + 1023 WP_000361402.1 helicase UvrD -
NL407_RS00970 (155551) 155551..156237 - 687 Protein_193 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / catA1 / tet(B) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD iutA / iucD / iucC / iucB / iucA 1..174496 174496
- flank IS/Tn - - 155551..155898 347


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T269951 WP_001159871.1 NZ_CP117050:c151227-150922 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT269951 WP_000813630.1 NZ_CP117050:c151447-151229 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References