Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 150922..151447 | Replicon | plasmid p174_MLI106-4 |
Accession | NZ_CP117050 | ||
Organism | Escherichia coli strain MLI106K4 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | NL407_RS00940 | Protein ID | WP_001159871.1 |
Coordinates | 150922..151227 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | H9TJP1 |
Locus tag | NL407_RS00945 | Protein ID | WP_000813630.1 |
Coordinates | 151229..151447 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL407_RS00925 (146884) | 146884..148050 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
NL407_RS00930 (148638) | 148638..149393 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
NL407_RS00935 (150115) | 150115..150921 | - | 807 | WP_000016970.1 | site-specific integrase | - |
NL407_RS00940 (150922) | 150922..151227 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NL407_RS00945 (151229) | 151229..151447 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NL407_RS00950 (152007) | 152007..152237 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
NL407_RS00955 (152234) | 152234..152650 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
NL407_RS00960 (152725) | 152725..154290 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
NL407_RS00965 (154275) | 154275..155297 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
NL407_RS00970 (155551) | 155551..156237 | - | 687 | Protein_193 | IS1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / catA1 / tet(B) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..174496 | 174496 | |
- | flank | IS/Tn | - | - | 155551..155898 | 347 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T269951 WP_001159871.1 NZ_CP117050:c151227-150922 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CEF5 |